KEGG   Rhodobaca barguzinensis: BG454_04045Help
Entry
BG454_04045       CDS       T05218                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rbg  Rhodobaca barguzinensis
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rbg03009]
    BG454_04045
Enzymes [BR:rbg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BG454_04045
Ribosome biogenesis [BR:rbg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BG454_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 GSH-S_N
Motif
Other DBs
NCBI-ProteinID: ATX65102
UniProt: A0A2K8K6L1
Position
848239..849294
Genome map
AA seq 351 aa AA seqDB search
MAEEPFTEIEVRIGPQPPARLDKALARDVPEGQGLSRSRVVKLIEEGAVTRGAEVLDNVR
LKVAEGDVLTLRFSQPVEVETRAQKIALDIVWEDDELIVLNKPAGMVVHPAPGSPDQTLV
NALLHHCGDSLSGIGGEKRPGIVHRIDKETSGLLVVAKTDRAHQGLAAQFERHSVIRRYL
ALVHGVPDAADPRLRGLRGVSFEAGNILKVTSQLARSKNDRQKQAVVWSNGRHAVTRARV
LESFGSPPALALMECWLETGRTHQIRVHLSYAGHGLVGDPVYGGRRKLSDRALGSAGVAA
CAGFSRQALHAATLGFVHPVSGENLDFSAPLPADMEALLSALRPSQENTSE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagagcctttcacagagatcgaggtcaggattgggccgcagccccctgcacgg
cttgataaagccttggcgcgcgatgtgccagaggggcagggcctgtcacgttcacgcgtg
gtcaagctgatcgaggagggggcggtcacgcgcggggccgaggtgctggacaatgtgcgc
ctgaaagttgccgagggtgatgttctgacattgcgcttcagccagcctgtcgaggtcgag
acgcgcgcgcagaagattgcgctggatattgtctgggaagatgacgagctgatcgtgttg
aacaagcctgcgggtatggtcgtgcatcctgcgcccggaagcccggatcagacccttgtg
aatgcgctgctgcatcattgcggtgacagcctgtcggggattggtggcgagaagcggccc
ggaattgtgcaccggatcgacaaggaaacatcgggcttgctggtggttgcgaaaacggac
cgggcgcatcaggggctggccgcgcaattcgaacgtcacagcgtcatccggcgctatctt
gccttggtgcatggggtacccgatgcggccgacccgcgcctgaggggcttgcgcggggtg
agtttcgaggcaggcaatattctgaaagtgaccagccagttggcccgcagcaagaatgac
cgtcagaaacaggccgtcgtctggtcaaatggtcgccatgccgtgacgcgcgcgcgggtg
ctggagagtttcggcagcccgcccgcgcttgcattgatggaatgctggctggagacgggg
cgcacgcatcagatccgcgtgcacctgtcctatgcaggtcacgggctggttggcgatccg
gtctatggggggcggcgcaaattgtcagatcgggcgcttgggtcggcgggtgtggcggcc
tgtgccggcttttcccgacaggcgctgcatgctgcgacattgggcttcgtgcaccctgtc
agtggcgagaatcttgacttttcggcaccgctgcccgccgatatggaggcgcttctctcc
gcgctgcgcccctcacaggagaacacatcggagtga

DBGET integrated database retrieval system