KEGG   Rhodobaca barguzinensis: BG454_06885Help
Entry
BG454_06885       CDS       T05218                                 

Definition
(GenBank) acetate/propionate family kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00430  Taurine and hypotaurine metabolism
rbg00620  Pyruvate metabolism
rbg00640  Propanoate metabolism
rbg00680  Methane metabolism
rbg01100  Metabolic pathways
rbg01120  Microbial metabolism in diverse environments
rbg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BG454_06885
   00640 Propanoate metabolism
    BG454_06885
  09102 Energy metabolism
   00680 Methane metabolism
    BG454_06885
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BG454_06885
Enzymes [BR:rbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BG454_06885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase NAD_binding_10 ACT
Motif
Other DBs
NCBI-ProteinID: ATX65583
UniProt: A0A2K8KCD6
Position
complement(1444903..1446054)
Genome map
AA seq 383 aa AA seqDB search
MNSDILILNAGSSSIKLTVFDRALNIRLTGAADAIGGAAHLRVGQEKRVLAMADHADALH
KIFAALARHGITLDRLSAVGHRVVHGGATLTEPQRITPETRGEIAACIPLAPLHNPHNLA
AIDEVARLAPDLPQFASFDTAFHASNPAVATHYALPPENAACGIRRYGFHGLSYSALVRN
LPDVTGAALPARVLACHLGNGASLCAIRAGKSVATTMGYSPLEGLTMGTRCGNIDANAVF
RLVEEQGLEAARHLLNHGSGLLGLSGHSADMRALSEAGTDASQFAIAHFCYWAARHAGSM
IMAMRGCDAVVFTGGIGENAANIRAEILKKMDWLGVELNAARNQSGGPRLSTDGSRVAVW
VVAADEEREIARDVIHLMPRASK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgacatcctgatcctgaatgccgggtcttcttcgatcaagctgacggtgttt
gatcgcgcgctgaatatacgcctgacaggggcggcggatgcgatagggggcgcggcacat
ctgcgtgtcggacaagagaaacgtgtgctggcaatggctgatcacgccgatgcactgcac
aagatatttgccgctttggcacgtcatggcatcacgttggatcggctctctgctgtgggc
caccgcgtcgtacatggtggcgcgacgctgacggaaccccagcgtatcacgcctgaaaca
cggggggaaatcgcagcctgcattccgctggctccactgcacaatccacataatcttgcc
gcgatagacgaggttgcgcggcttgcgccagacttgccgcaatttgccagttttgacaca
gcatttcacgccagcaacccggctgtagccacgcattacgcattgccgcctgaaaatgca
gcgtgcggcattcgtcgctacggctttcatgggctgagttactccgcactcgtgcggaac
ctgcctgacgtgacgggggctgccctgcccgcgcgggtgctggcgtgccatttgggcaat
ggcgcttcgctatgtgcgatacgcgcgggcaagtccgttgcaacgacaatgggctattcc
ccgctggaggggctgaccatgggcacacgctgcggcaatattgacgcgaatgccgtgttc
aggctggtcgaggaacaggggcttgaagccgcgcgccatttgctgaatcacggcagcggg
ctgttgggtctgtcgggccacagcgcagatatgcgcgccctgtccgaggccgggacagac
gccagccaatttgccattgcgcatttctgctattgggcggcgcgccatgctggtagtatg
attatggccatgcgcggctgtgatgcagtggtctttaccggcggcattggcgagaatgca
gccaatatccgcgccgaaatcttaaagaagatggattggctaggtgtcgagctcaacgct
gcgcgcaaccaatcgggtggcccacggctgagcacggatgggtcgcgcgtggcggtctgg
gttgtcgctgcggatgaagaacgcgaaattgcacgcgatgttatccatctgatgccccgc
gcctcaaaataa

DBGET integrated database retrieval system