KEGG   Rhodobaca barguzinensis: BG454_12655Help
Entry
BG454_12655       CDS       T05218                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00010  Glycolysis / Gluconeogenesis
rbg00020  Citrate cycle (TCA cycle)
rbg00620  Pyruvate metabolism
rbg01100  Metabolic pathways
rbg01110  Biosynthesis of secondary metabolites
rbg01120  Microbial metabolism in diverse environments
rbg01130  Biosynthesis of antibiotics
rbg01200  Carbon metabolism
Module
rbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BG454_12655
   00020 Citrate cycle (TCA cycle)
    BG454_12655
   00620 Pyruvate metabolism
    BG454_12655
Enzymes [BR:rbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BG454_12655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF1152 RnfC_N QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ATX66561
UniProt: A0A2K8KAT3
Position
2621572..2622873
Genome map
AA seq 433 aa AA seqDB search
MPTEILMPALSPTMEEGTLAKWLVKEGDSVASGDIIAEIETDKATMEFEAVEEGVIGKIL
IEAGTDAVKVNTPIAVMLGEGESASDIGAPSKAAPQATQEAAAAPTKAPSESSTKTSAPP
APKADGQRVFASPLARRIAAEKGIDLTQISGSGPHGRIVKADLADAKPAQASAAPADSAA
KPAAGAAMPAGPTADQVAKMYDGRDYEEVKLDGMRKTVAARLTEAKQTIPHFYLRREVQL
DALMKFRGDLNKQLEARGVKLSVNDFIIKACAMALQAVPDCNAVWAGDRMLRLKPSDVAV
AVAVEGGLFTPVLKDAHLKSLSALSAEMKDLAGRARNKKLAPHEYIGGAMAISNLGMFGI
ENFDAVINPPHGSILAVGAGLKKPVVGSDGELKVATVMSMTLSVDHRVIDGALGAEFLKE
VVAYLENPVTMLA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagaaatcctgatgcccgcgctctctcccacaatggaagaaggcacgctggca
aaatggctggtcaaggaaggcgacagcgttgcctctggcgacatcattgccgaaattgaa
actgacaaggccacgatggaattcgaggccgtggaggaaggtgtcatcggcaagatcctc
attgaggctggcaccgacgcggtcaaggttaacacgccgattgcggtaatgctgggtgag
ggcgaaagcgcaagcgacatcggtgctccgtcgaaagcagcaccgcaggcgacccaggaa
gccgccgccgccccgacaaaggcaccgtcagaaagcagcaccaaaacctcggcgccgcct
gccccaaaagccgatggtcagcgcgtctttgcctcgccactcgcacggcgcattgcagca
gagaaaggcattgatctgacgcagatcagtgggtctggcccgcatgggcggatcgtcaag
gccgatctggcagatgccaagcccgcacaggccagcgcggccccagccgatagcgcggcc
aaacccgccgctggcgctgccatgcccgctgggccaacagcggatcaggtcgccaagatg
tatgacgggcgcgattatgaagaagtcaaacttgatggtatgcgcaagactgtcgcggcc
cgtttgaccgaagccaagcagacgatcccacatttctatctgcgccgcgaggtgcagctt
gacgcgctgatgaagttccgtggtgatctgaacaagcagcttgaagcgcgtggcgtcaaa
ctgtcggttaatgacttcatcatcaaggcctgcgccatggcgttgcaagcggtgccagat
tgtaatgcagtctgggccggtgaccggatgctgcgcctgaaaccgtcggatgtggctgtc
gcggtcgcagtcgaaggcgggctgttcacgccggtattgaaggacgcgcatctcaagtca
ctttctgccctgtcggcagaaatgaaagacctcgctggccgtgcgcgcaacaagaagctt
gcgccgcacgaatatatcggcggcgcgatggcgatttccaatctggggatgttcgggatc
gagaatttcgatgcggtgatcaacccgccgcatggctctatcctcgctgtcggcgcaggg
ttgaagaagcctgtcgttggcagcgatggcgagttgaaggtggcaaccgtcatgtctatg
acgctgtccgtcgaccaccgtgtgattgatggggcgctgggggctgaattcctgaaagag
gttgtcgcctatctggaaaatccggtcacaatgctggcttga

DBGET integrated database retrieval system