KEGG   Rhodobaca barguzinensis: BG454_15735Help
Entry
BG454_15735       CDS       T05218                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
rbg  Rhodobaca barguzinensis
Pathway
rbg00450  Selenocompound metabolism
rbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BG454_15735 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbg03016]
    BG454_15735 (selD)
Enzymes [BR:rbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BG454_15735 (selD)
Transfer RNA biogenesis [BR:rbg03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BG454_15735 (selD)
 Prokaryotic Type
    BG454_15735 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 AIRS_C AIRS Pyr_redox AlaDh_PNT_C Trp_halogenase DAO Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-ProteinID: ATX67090
UniProt: A0A2K8KKX6
Position
3243067..3245235
Genome map
AA seq 722 aa AA seqDB search
MYMPLPLTRDLVLIGGGHTHALVLHRWAMHPLPGVRLTVINPDPVAPYTGMLPGFIAGHY
AREELDIDLVRLARRAGARLVLGKARGIDREARLVNVPGRPPIPYDLAAIDIGITSDLPM
IPGYADHAVSAKPLGRYAQQWDAWRAKLEQGAVRAQIVVIGGGVAGVELALAMAYRLQGR
TAQITIVQSGALLPNIGAQAKARLIGHLKRSSITIREQAQVCEVTQKGVTLADGTHIAAS
LTLGAAGSRPQDWLRDTGLDLTDGFITVDPFLRSVTDPAIFAVGDCAHMAHAPRAKAGVY
AVRQAPYLFDNLRAALGVGRLRAYKPQRDYLKLVSLGGKTALADKWSLPLEGRWLWGLKD
RIDAKFMGQFRDPRPMPPALPPAYAVGLAEMLGDKPLCGGCGAKMGAQTLRAALPDVARA
DVEAGIGDDAAILRIGDARQVIATDHLRALTDDPWMMARIAATHALGDIWAMGARPQAAL
AQVTLPHMAPELQARTLREVMAGAQSVLDPAGVALIGGHSAMGAEMQLGFTLTGLLDGAA
TKKAGAQPGDALILCKPLGTGVIMAAEMQWAAPGAVVANALQMMVQSQAKAAELLAPHAH
AMTDVTGFGLAGHLAEMLAQDGLSAQLDLSALPILDGAEALIAAGYHSSLAAANRAALRA
LLDAAETPRAALLVDPQTAGGLLACVPAKQAETLVEKLQAAGFQAATIGEITGKDGPHIV
AA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgcctttgcccctgacgcgtgatcttgtgttgatcggcggcgggcatacgcat
gcgctggtgctgcatcgctgggccatgcaccctttgccgggggtgcggctgacggtgatc
aacccagacccggtggcgccctatactggcatgttgccggggtttattgctggccactat
gcgcgcgaggaactggatatagaccttgtccggcttgcgcggcgcgcgggcgcacggctg
gtgctgggcaaggcgcgcggcatcgaccgcgaggcgcgtctggtaaatgtgcccggtcgg
cccccaattccctatgacctggccgcgatcgacatcggcatcacctctgatctgcccatg
atccccggctatgcggatcacgcggtttcggccaagccacttgggcgctatgcccagcaa
tgggacgcgtggcgcgccaagctggaacagggggcggtccgcgcgcagatagtcgtgatc
ggcggcggggtcgccggggtggaactggccttggcgatggcctatcggctgcaaggccgc
acagcacagatcaccatcgtgcaatctggcgcattgctgcccaatatcggcgcgcaagcg
aaggcccggctgattggtcacctgaaacgctcttcaatcacgatccgcgaacaggcgcag
gtgtgcgaggtcacccaaaagggcgtgacgctggccgatggaacacacatcgcggcgagc
ctgactctcggggcggcggggtcgcggccgcaagactggctgcgcgacacggggctggac
cttacagacgggttcatcacagttgatccattcctgcgctctgtcacagatccagcaatt
ttcgcagtgggcgattgcgcgcatatggcccatgcgccgcgcgccaaggcaggcgtctat
gccgtgcgtcaggcgccctatctgttcgacaacctgcgcgccgcactgggtgtcgggcga
ctgcgcgcctacaagccgcagcgcgattatctgaaactggtgtcgctggggggcaagacc
gcgctggcggacaaatggtcgctgccgctggaagggcgctggctttgggggctgaaagac
cggattgatgccaaattcatgggccagttccgtgacccgcgcccgatgccccctgccctg
ccgcccgcttatgccgttgggctggcagagatgctgggggacaaacccctatgcggcgga
tgcggcgcgaaaatgggcgcgcagacgctgcgcgccgccctgccagatgtggcgcgcgcc
gatgtcgaggccggtattggcgatgatgccgcaattttgcgtatcggcgatgcgcgtcag
gtcatcgcaaccgaccatctgcgcgcgctgacagatgacccgtggatgatggcgcggatt
gcggccacccacgcgcttggcgatatctgggcgatgggcgcgcgcccgcaagcggcactg
gcacaagtgacgctgccgcatatggcaccggaattgcaggcccgcaccctgcgcgaggtg
atggcgggcgcgcaatccgtgctggaccctgcaggcgtcgcgctgatcggcgggcatagc
gcgatgggggccgaaatgcagttgggctttacgctcaccggcctgctggacggggccgcc
accaaaaaggcaggcgcgcagcccggcgatgcgctgatcctgtgcaagcccttggggacg
ggtgtcatcatggcagccgaaatgcaatgggccgcccccggcgctgtggttgcgaatgcc
ttgcagatgatggtgcaatcccaggccaaggcggcggaactgctggcaccacacgcccat
gccatgaccgatgtcaccggctttgggctggccggtcatctggccgagatgctggcccaa
gacgggctgtcggcgcagttggaccttagtgcactgccgatactggacggggccgaagcg
ctgattgcggcagggtaccattccagccttgccgccgcgaaccgcgcggcgctgagggcc
ttactggatgcagctgaaacaccgcgcgcggcgcttctggttgacccgcagacggcaggc
gggttgctggcctgtgtcccggccaagcaagccgaaacacttgttgaaaaattgcaagcg
gcaggttttcaggctgcaaccatcggcgagattacgggcaaggatgggcctcatatcgtc
gctgcgtaa

DBGET integrated database retrieval system