KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_12105Help
Entry
B4966_12105       CDS       T05394                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00790  Folate biosynthesis
rbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B4966_12105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbh04147]
    B4966_12105
Enzymes [BR:rbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B4966_12105
Exosome [BR:rbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B4966_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUM00820
UniProt: A0A2K9LF19
Position
2503202..2503582
Genome map
AA seq 126 aa AA seqDB search
MDTSPEACHFKERIMEERCDLSARHCVPCEGGVPALSVEAARQLVDTLDGWVLADAKIEK
TFRFRNHHETMAFVNAVAWISHREDHHPELTVGYADCRVRYWTHAIGGLSENDFICAAKI
DRLFSL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggataccagtccagaggcgtgtcatttcaaggagcgcatcatggaagagcgttgcgat
ctatctgcccggcactgtgtgccgtgcgaagggggcgtgccggcgctgagcgtcgaggcc
gcgcggcagcttgtcgatacgctcgacggctgggtgctcgcggatgcgaagatcgaaaaa
acctttcgctttcgcaaccaccacgagacgatggcgttcgttaatgcggtggcgtggata
tcgcatcgcgaggatcaccaccccgaactcaccgtgggctacgcggactgccgggtgcgc
tattggacgcacgcgatcggcggcctctctgaaaacgatttcatctgcgcggccaagatc
gaccgcttgttctcgctttag

DBGET integrated database retrieval system