KEGG   Robiginitalea biformata: RB2501_13069Help
Entry
RB2501_13069      CDS       T00992                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00010  Glycolysis / Gluconeogenesis
rbi00620  Pyruvate metabolism
rbi00640  Propanoate metabolism
rbi00680  Methane metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RB2501_13069
   00620 Pyruvate metabolism
    RB2501_13069
   00640 Propanoate metabolism
    RB2501_13069
  Energy metabolism
   00680 Methane metabolism
    RB2501_13069
Enzymes [BR:rbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RB2501_13069
Lipid biosynthesis proteins [BR:rbi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RB2501_13069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: EAR15260
UniProt: A4CK61
Position
2132746..2134656
Genome map
AA seq 636 aa AA seqDB search
MSNYHIKHLEEYFQVYRKSVRDPEAFWEEIAEEHFVWRKKWDRVLRWDFKKPEVAWFEGA
RLNITENCLDRHLPVRGDKTAILFEPNDPSGEAQHITYKELHERVCRMANVLKEHGVKKG
DRICIYLPMIPELAVAVLACARIGAIHSVVFAGFSSNALATRINDSDCKLVITSDGSYRG
AKTLNLKSIVDTALEDCPGVDTVLVARRTGEEVAMKDGRDKWLQPLLDEAYADCVAEIMD
AEDPLFILYTSGSTGKPKGMVHSCGGYMVYTAYTFKNIFQYREQDVYWCTADIGWITGHS
YIVYGPLANGATTVMFEGVPSYPDYGRFWEVVEKHRVNQFYTAPTAIRALAKESLDYVEK
YDLSSLKVLGSVGEPINEEAWHWYNNNIGRNKCPIVDTWWQTETGGIMISPIPFVTPTTP
TFATLPFIGIQPALMDEEGNEIKGNQVSGRLCIKFPWPSMARTIWGNHDRYRDTYFSAYA
DKYFTGDGASRDAVGYYRITGRVDDVIIVSGHNLGTAPIEDSINEHPAVAESAIVGFPHD
VKGNALYGFVILKETGESRNRENLHKEINQQITEQIGPIAKLDKIQFVPGLPKTRSGKIM
RRILRKIAAGQTDDLGDISTLLNPEVVQEIIDQAEV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactaccatatcaaacacctggaggagtatttccaggtgtatcgcaaatctgta
cgggacccggaagccttttgggaggaaatcgccgaagagcactttgtctggcgaaagaaa
tgggaccgggttttgcgctgggacttcaagaaacccgaagtggcctggtttgaaggagcc
cggctgaatattaccgaaaactgcctggaccggcacctgcctgtgcggggcgataaaacc
gctatcctctttgagcccaacgacccgtccggggaggcccagcacatcacctataaggaa
ttgcacgaacgcgtgtgccggatggccaatgtactgaaggaacacggcgtgaaaaagggc
gaccgcatctgcatctacctgcctatgatcccggaactggccgtcgctgtactggcctgt
gcgcggatcggggccatccactccgtggtttttgccggtttctcctccaacgcgctggct
acccgtatcaacgacagcgattgcaaactggtcatcacctccgacggttcttaccggggt
gcaaaaaccctcaacttgaaaagtatcgtggatacggccctggaagattgcccgggggtg
gataccgtactggtggcgcggcgcaccggggaagaggtagccatgaaggacggccgggac
aaatggctgcagcccctgttggacgaggcgtatgcggattgcgtggccgaaatcatggat
gcggaagacccgctctttatcctgtatacctccggttccaccggcaaacccaaggggatg
gtacacagttgcggggggtatatggtctacacggcctatacttttaagaatattttccag
taccgggaacaggacgtgtactggtgcacggcggatattggttggattaccggccattcc
tacatcgtctacggcccgctggccaacggggctaccacggtgatgtttgagggggtgcct
tcctatccggactacggccggttctgggaggtggtggaaaaacaccgggttaaccagttt
tatacggcacccacggccatccgcgccctggccaaggaaagcctggactatgtggagaag
tacgacctgtcttccctgaaggtcctgggctctgtgggggaacccatcaacgaggaagcc
tggcactggtacaacaacaacatcgggcggaacaagtgcccgattgtggatacctggtgg
cagaccgaaaccggggggatcatgatcagccccatcccgtttgtcacccccaccacgccc
acctttgctaccctgccgtttatcggcatccagccggccctgatggacgaggaagggaat
gagatcaaggggaaccaggtaagcggccgtttgtgcatcaaattcccatggccctccatg
gcccgtaccatctggggcaaccacgatcgctaccgggacacctatttctcggcctatgcg
gacaaatactttacaggggacggcgcctcaagggacgccgtgggttattaccggattacg
ggtcgcgtggacgatgtgatcatcgtgagcggacacaacctggggactgcgcccatcgag
gacagcatcaacgaacacccggctgtggccgaatcggccattgtgggctttccccacgac
gtcaaggggaacgcgctctatgggtttgtcatccttaaggaaaccggggaatcccggaac
cgggaaaacctgcacaaggaaatcaaccagcagatcaccgaacagatcggcccgattgcc
aagctggacaagatccagtttgtccccggcctgcccaagacccggagcggcaagatcatg
cgtcggatcctccggaagattgccgccggccagaccgacgatttgggggatatcagcacg
ctgctgaacccggaagtggtgcaggagatcatcgaccaggcagaagtatag

DBGET integrated database retrieval system