KEGG   Rhodobacter blasticus: B6K69_03495Help
Entry
B6K69_03495       CDS       T05669                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00860  Porphyrin and chlorophyll metabolism
rbl01100  Metabolic pathways
rbl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B6K69_03495
Enzymes [BR:rbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     B6K69_03495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 NB-ARC CBP_BcsQ AAA_10
Motif
Other DBs
NCBI-ProteinID: AWD20843
Position
731905..732807
Genome map
AA seq 300 aa AA seqDB search
MSPRDDIPNLSGLDGEGSVQVHQDANLKIEGAKVFSVYGKGGIGKSTTSSNLSAAFSMLG
KRVLQIGCDPKHDSTFTLTGRLQETVIDILKSVDFHAEELRPEDFVTTGFNGVMCVEAGG
PPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGFAAPLQHADRAVIVTAN
DFDSIYAMNRIIAAVQAKSNNYKVRLAGCVANRSRETNEVDRYCDRVGFKRLAHMPDVDA
IRRSRLKKKTLFEMPDEEDIVLARAEYIRLAETLWRSVNEPPVLPTSLPDREIFELLGFD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcccccgtgacgacattccaaacctgagcggccttgacggtgaaggctcggtccag
gtccatcaggacgccaacctcaagatcgagggggccaaggtcttttccgtctacggcaag
ggcgggatcggcaaatcgaccacctcgtcgaatctgtcggcggcgttttccatgttggga
aaacgcgtgctgcagatcggctgcgatcccaagcatgacagcaccttcaccctgaccggg
cggctgcaggaaacggtgatcgacatcctcaagtcggttgatttccacgccgaggagctg
cgccccgaggatttcgtgaccaccggcttcaacggcgtcatgtgcgtcgaggcgggcggc
ccccccgccggcaccggctgcggcggctatgtcgtcggccagacggtcaagctgctgaag
cagcatcacctgctggaagacaccgacgtggtgatcttcgacgtgttgggcgatgtggtc
tgcggcggctttgccgcgcccctgcaacacgccgaccgcgcggtgatcgtgaccgcgaac
gactttgacagcatctatgcgatgaaccgcatcatcgccgccgtgcaggccaagtcgaac
aactacaaggtccgtctggccggttgcgtcgccaaccgctcgcgcgaaacgaacgaggtt
gaccgctactgcgaccgcgtcggtttcaagcggctggcgcatatgcccgacgtggatgcg
atccgccggtcgcgcctgaaaaagaagacgctgttcgagatgccggacgaggaagacatc
gttctggcccgcgccgaatacatccggctggccgaaacgctgtggcgctcggtcaacgaa
ccgcccgtgctgccaacctcgctgcccgaccgcgaaatcttcgaactcctgggttttgac
tga

DBGET integrated database retrieval system