KEGG   Rhodobacter blasticus: B6K69_03565Help
Entry
B6K69_03565       CDS       T05669                                 

Definition
(GenBank) hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00430  Taurine and hypotaurine metabolism
rbl00620  Pyruvate metabolism
rbl00640  Propanoate metabolism
rbl00680  Methane metabolism
rbl01100  Metabolic pathways
rbl01120  Microbial metabolism in diverse environments
rbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B6K69_03565
   00640 Propanoate metabolism
    B6K69_03565
  09102 Energy metabolism
   00680 Methane metabolism
    B6K69_03565
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    B6K69_03565
Enzymes [BR:rbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     B6K69_03565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AWD20856
Position
complement(745586..746671)
Genome map
AA seq 361 aa AA seqDB search
MWLVVNAGSSSVKLVVFDAGLRDVARATVDRIGAGGPTTHAEAMVEGLGRMGLAPAALTA
AAHRVVHGGVALTAPQRVTPAVIAGIEACVPLAPLHNPGNLTGIRAVEALAPGLPQYVSF
DTAFHATNPDVATAYAIPAEERARGLRRFGFHGLSYAALVRILRARGALTRRVLAFHLGN
GVSACAILDGASVASSMGWSPVEGLTMGTRPGNLDPMVALDLAERHGVDGARAMLNRRSG
LLALGGHSDMRALHEAGTPEAAFAIDHFCYWAIRHAGSLIAAMGGVETIVFTGGVGENDF
SVRGRILDGLSWVGVAYDANANRQNAGALHLAKSDVAIWTVPADEERQIAQEAQTVRECE
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttgtggtcaatgccggatcgtcctcggtcaagctggtggtgttcgatgcggga
ctgcgggatgttgcccgcgccacggttgaccgtatcggggccggtggtcccaccacccat
gccgaggccatggtcgaagggctgggccggatggggcttgcgcccgccgcgctgacggcg
gcggcgcatcgggtggtgcatggcggggtggcgctgaccgcgccgcagcgtgtaacaccc
gccgtgatcgccgggatcgaggcctgcgtgcccctggcgccgctgcacaatcccggcaac
ctgaccggcatccgcgcggttgaagcgttggcgccgggcctgccgcaatatgtgtctttt
gacacggcgttccatgccaccaaccccgatgtggcaaccgcctatgcgattccggccgag
gagcgggcccgcgggctgcgccgttttggctttcacggcctgtcctatgcggcgctggtg
cgcatcctgcgtgcacggggcgcgctgacccggcgggtgctggcgtttcatctgggcaac
ggggtgtcggcctgtgccatccttgacggcgcctcggtcgcctcgtccatggggtggtct
ccggtcgaggggctgaccatgggcacaaggccgggcaatctggacccgatggttgcgctg
gatctggccgaacggcacggcgttgacggggcgcgggcgatgctgaaccgccgttcgggc
cttttggcattgggggggcacagcgacatgcgggcgctgcacgaagcgggcacgcccgag
gccgcctttgccattgaccatttctgttactgggctatccgccatgctggcagcctgatt
gccgccatgggtggagtcgaaacaatcgtcttcaccggcggtgttggggagaacgatttt
tccgttcgtggccgaattttggacgggctttcctgggtgggtgtggcctatgatgccaat
gccaaccggcagaacgcgggggccctgcatttggcgaaatcggatgtcgcaatctggaca
gtgccggctgacgaggaacggcagattgcacaggaggcgcagacggtgagggagtgtgag
gggtga

DBGET integrated database retrieval system