KEGG   Rhodobacter blasticus: B6K69_05680Help
Entry
B6K69_05680       CDS       T05669                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00250  Alanine, aspartate and glutamate metabolism
rbl00330  Arginine and proline metabolism
rbl01100  Metabolic pathways
rbl01110  Biosynthesis of secondary metabolites
rbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B6K69_05680
   00330 Arginine and proline metabolism
    B6K69_05680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rbl03000]
    B6K69_05680
Enzymes [BR:rbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     B6K69_05680
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     B6K69_05680
Transcription factors [BR:rbl03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    B6K69_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AWD21225
Position
complement(1178026..1181478)
Genome map
AA seq 1150 aa AA seqDB search
MTANAWTTITTESLADEATLVRRLIAEAALTPSARARITTEAAALVTRIRAGGKPGLMEV
FLAEYGLSTDEGIALMCLAEALLRVPDAETMDALIEDKIAPSNWGRHLGRSASSLVNAST
WALMLTGKVLEDREPGVVGHLRAAVRRLGEPVIRTAVGRAMKEMGRQFVLGETIEGAMDR
ARDLESKGYTYSYDMLGEAARTEADARRYHLAYSKAITAIAAAAHSADLRDNPGISVKLS
ALHPRYEIAKRERVMQELVPRLRSLATLARTAGLGFNIDAEEADRLSLSLEVIEAVLADP
ALKGWDGFGVVVQAYGRRAGAVLDWLYALSQRLDRRIMVRLVKGAYWDSEIKRAQVLGLT
SFPVFTRKQATDVSYIANARKLLGMTDRIYPQFAGHNAHTVAAILHMAEETGTPLRDFEF
QRLHGMGERLHDLVLTDRGTRCRIYAPVGAHRDLLAYLVRRLLENGANSSFVNQIVNEEV
PATEVAACPLTHMERVTPLENPAVRPAPQLFPGRRNAKGWDLTDAADLAAIDAARAPHQD
RLFEATPLIAAPLRGAERLAVTNPATGALVGHVTTAAPEDVDAALAAARRWDASAATRAE
ILTRAADLYEENFGPIFALLAREAGKTLADAVSELREAVDFLRYYAAGAPALRAPARGTF
ACISPWNFPLAIFTGQIAAALAAGNAVLAKPAEQTPLIAALAVGLLHQAGVPATALQLLP
GDGRVGAALTRDPRVQGVAFTGSTETAQLIRRAMADNLDPAAPLIAETGGLNAMLVDSTA
LPEQAVRDILASSFQSAGQRCSALRCLYVQEDVAETVKRMLFGAMDDLAAGDPWHLSTDI
GPVIDAEAQAAISAYVAAARSQGRVLKETAVPATGTFVAPAVLSVPSIKAMEREIFGPVL
HIATFRAGEIDRVIDEINATGYGLTFGLHSRIDDRVQQVVDRLRVGNAYVNRNQIGAVVG
SQPFGGEGLSGTGPKAGGPDYLTRFTAAPAPSAAPAADSAPLAEAEVARRLAAVPAPVAE
LQAEDLPGPTGESNRLRHGPRAPFLCLGPGAEAARAQAAAVTALGGLAVEAPGLPPQALA
RLQGFSGALWWGDEPGARARAQALASRPGPILPLVTGTPDRAHVLIERHVCIDTTAAGGN
ARLLAEVSAD
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacgcttggaccaccatcaccaccgaaagccttgccgacgaggccaccctc
gtccgtcgcctcatcgccgaggccgccctcaccccctcggcccgtgcccgcatcaccacc
gaggccgccgccctggtgacccgcatccgcgccggcggcaagcccggcctgatggaggtg
ttcctggccgaatacggcctttccaccgatgaaggcatcgccctgatgtgcctggccgaa
gccctgctgcgcgtgcccgatgccgaaaccatggatgcgctgatcgaggacaagatcgcc
ccctccaactggggccgccatctgggccgctcggcctcctcgctggtcaacgcctcgacc
tgggccctgatgctgaccggcaaggtgctggaagaccgcgaacccggcgtcgtcggccac
ctgcgcgccgccgtccgccgcctgggcgaacccgtcatccgcaccgccgtcggccgcgcg
atgaaggaaatgggccgccagttcgtgctgggagaaaccatcgaaggcgccatggaccgc
gcccgcgatctggaatccaagggctatacctacagctatgacatgctgggcgaagccgcc
cgcaccgaggccgacgcccgccgctaccacctggcctattccaaggcgatcaccgccatc
gccgccgccgcccacagcgccgacctgcgcgacaatcccggcatctcggtcaagctctcg
gccctgcacccccgctacgaaatcgccaagcgcgaacgggtgatgcaggaactggtgccc
cgcctgcgttcgctggccacgctggcccgcaccgccggccttggcttcaacatcgacgcc
gaagaggccgaccgcctgtcgctctcgctcgaggtgatcgaagccgtcctggccgacccg
gcgctcaagggctgggacggcttcggtgtcgtggtgcaggcctatggccgccgcgccggg
gccgtgcttgactggctttacgccctgtcgcagcggcttgaccgccgcatcatggtgcgt
ctggtcaagggcgcctattgggacagcgaaatcaagcgcgcgcaggtgctgggcctgacc
agcttccccgtcttcacccgcaagcaggcgaccgatgtcagctacatcgccaacgcccgc
aaattgctgggcatgaccgaccggatctatccgcaattcgccggccacaacgcccatacc
gtggccgcgatcctgcacatggccgaagaaaccggcacgcccttgcgcgatttcgaattc
cagcgcctgcatggcatgggcgaacgcctgcatgatctggtgctgacagaccggggcacc
cgctgccgcatctatgcccccgtcggcgcacatcgcgacctgctggcctatctggtgcgc
cgcctgctggaaaacggcgccaactccagcttcgtgaaccagatcgtcaacgaagaggtg
cccgcgaccgaagtcgccgcctgcccgctgacccatatggaacgggtcacgccgctggaa
aaccccgccgtccggcccgcgccgcagcttttccccggccgccgcaacgcgaagggctgg
gatctgaccgatgccgccgatctggcggccatcgatgccgcccgcgccccccatcaggac
cggctgttcgaggccactccccttatcgccgcgcccctgcgcggggcggaacggctggcc
gtcaccaaccccgccaccggcgcgcttgtgggccatgtcaccaccgccgcgccggaagac
gtggacgccgcccttgccgccgcccggcgctgggatgcctccgccgccacccgcgccgaa
atcctgacccgcgccgccgatctgtacgaagaaaacttcggcccgatcttcgcccttctt
gcccgcgaagccggcaagaccctggccgatgccgtgtccgaactgcgcgaggcggtggat
ttcctgcgctactacgctgccggcgcgcctgcgctgcgcgccccggcgcgcggcaccttc
gcctgcatcagcccgtggaacttcccgctggccatcttcaccggccagatcgccgccgcg
ctggccgccggcaatgccgtgctggccaagcccgccgaacagacgccgctgatcgccgcg
ctggcggtggggctgctgcatcaggccggggtgcctgccacggcgctgcaactcctgccc
ggcgacggccgcgtcggcgccgcgctgacccgcgatccgcgcgtgcagggcgtggccttc
accggctcgaccgaaaccgcgcaactgatccgccgcgccatggccgacaatcttgatccc
gccgcgccgctgatcgccgaaaccggcgggctgaacgccatgctggtggacagcaccgcc
ctgccggaacaggcggtgcgcgacatcctcgcctccagcttccagtcggccggccagcgc
tgctcggcgctgcgctgcctctatgtgcaggaagacgtggccgaaaccgtcaagcggatg
ctgttcggcgcgatggacgatctggccgccggcgatccctggcacctgtccaccgacatc
ggccccgtcattgatgccgaggcgcaggcggccatttccgcctatgtcgccgccgcccgc
agccagggccgggtgctgaaggaaaccgccgtgcccgccaccggaaccttcgtcgcgccc
gccgtcctgtcggtgccctcgatcaaggcgatggagcgggaaatcttcggccccgtcctg
catatcgccaccttccgcgccggcgagatcgaccgcgtgatcgacgagatcaacgccacc
ggctacggcctgaccttcggcctgcacagccgcatcgacgaccgggtgcagcaggtggtg
gaccggctgcgcgtcggcaacgcctatgtgaaccgcaaccagatcggcgccgtggtgggc
agccagcccttcggcggcgaagggctgtcaggcaccggccccaaggccggtggccccgac
tacctgacccgcttcaccgccgccccggccccttcggccgcccccgccgctgacagcgcc
ccgctggccgaggccgaggtcgcccgccgtctggccgccgttccggcccccgtggccgaa
ctgcaggccgaagacctgccggggccgaccggcgaatcgaaccgcctgcgccacggcccg
cgcgcgcccttcctctgccttggcccgggggccgaggccgcccgcgcccaggccgccgcc
gtcaccgcgctgggcggtctggcggtggaagcccccggcctgccgccgcaggcgctggcc
cggctgcaaggattctcgggggcgctctggtggggcgatgaacccggcgcgcgcgcccgc
gcgcaggcgctggccagccgccccggcccgatcctgccgctggtcaccggcacccccgac
cgcgcgcatgtgctgatcgaacgccacgtctgcatcgacaccaccgccgccggcggcaac
gcccgcctgctggccgaagtctccgccgactga

DBGET integrated database retrieval system