KEGG   Rhodobacter blasticus: B6K69_10730Help
Entry
B6K69_10730       CDS       T05669                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
rbl  Rhodobacter blasticus
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B6K69_10730
Enzymes [BR:rbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     B6K69_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AWD22093
Position
complement(2200482..2201312)
Genome map
AA seq 276 aa AA seqDB search
MRAALIQLNVSDDPQANLVQTLDWCRQAVAGGAGFLLTPEMTNGLSSSRDHQRSVFRHEE
DDETLAALRAFAAQAGVWLLIGSLGLLTHDADGRFANRSFLIGPEGDIRARYDKIHMFDV
NVSETEVYRESASYRPGGRAVVTEVPFGPVGMAVCYDLRFPHLFRRLAQGGARVLTIPAA
FNHITGAAHWETLVRARAIETGCFVLAPAQTGFHAESQGKGRRTHGHSLAVAPWGEVLAD
AGTEPGVTFVDLDLSQVDQARGRVPSLHHDRGFDGP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgccctgatccagttgaatgtcagcgacgacccgcaggcgaaccttgtgcag
acgctggactggtgccgtcaggcggtggccggcggggccggcttcctgctgacgcccgaa
atgacgaacgggctgtcgtcaagccgtgaccatcagcgcagcgtcttccggcatgaagag
gacgatgagacgctggccgcgctgcgggcgttcgcggcgcaggccggggtctggctgctg
atcgggtcgctgggtctgctgacccatgatgcggacgggcggtttgccaaccgttccttc
ctgatcgggccagagggcgacatccgggcccggtatgacaagattcacatgttcgacgtg
aacgtgtcggaaaccgaggtttaccgcgaaagcgccagttatcgccccgggggccgggcg
gtggtgaccgaggtgccctttggccctgtgggcatggcggtctgttatgacctgcgtttc
ccgcacctgttccgccggctggcgcagggcggcgcgcgggtgctgaccattccggcggcc
ttcaaccacatcacgggcgcggcgcattgggaaacgctggtccgggcgcgggcgatcgag
accgggtgctttgttctggcgccagcgcaaaccgggtttcatgccgaatcgcagggcaag
ggccgccgcacccatggccattcgctggccgtcgccccctggggcgaggttctggccgat
gccggcaccgaaccgggcgtgacttttgtcgatcttgatctctcacaggtcgatcaggcg
cggggtcgcgtgccctcgctgcaccatgaccgcgggttcgacgggccatga

DBGET integrated database retrieval system