KEGG   Rhodobacter blasticus: B6K69_12310Help
Entry
B6K69_12310       CDS       T05669                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00860  Porphyrin and chlorophyll metabolism
rbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B6K69_12310
Enzymes [BR:rbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     B6K69_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AWD22358
Position
complement(2531382..2532956)
Genome map
AA seq 524 aa AA seqDB search
MTAPLPPDDAPPPLPKIEVPLLDPPPPRRGRALMIQGTSSDVGKSLLVAGLCRAYARRGL
KVAPFKAQNMSNNAAVTADSDLSPDADGTPRRGEIGRAQALQARAAGLAPSIHMNPVLLK
PQAMVGSQVVLRGRALGNWPARHYHGLKPLLLPAVLDSYRRVAAEADLVLVEGAGSGTET
HLRRSDIANMLFAGAADLPVVLLTDNDRGGAMAAVVGSWLLHTPAERARIRGFLVNKFRG
QFALYEPACRTMTNVTGWPFLGAARWFDAAALLPAEDALALERPGRSAGGGLVIAVPQID
RVANFDDLDPLSAEPGVDLRWVKPGQPIPANADVVLLPGSKTTRSALEALRKQGWDIDIL
AHHRRGGRVVGICAGFQILGRVVRDPEGLEGPAGETAGLGLLEVETTITRDKKLVEVAAT
DARSGTRVTGYEMHMGRTTGAGLDRPWLRLDGVPEGAISADGRVMGGYIHGIFGADGYRR
HWLAAMGGRASGLDHEAQVDRTLDALADQLEADLDLDALLALAR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccctgccgcccgacgatgccccgccgccgctgcccaagatcgaggtgccc
ctgctggacccgccgccgccgcgacggggccgcgcgctgatgatccagggcaccagttcg
gacgtgggcaaaagcctgctggtggcgggcctgtgccgcgcctatgcccggcgcgggctg
aaggtggcgccgttcaaggcgcagaacatgtcgaacaacgccgccgtcacggccgacagc
gacctgtcgcccgatgccgacggaacgccccggcgcggcgaaatcggccgggcgcaggcc
ttgcaggcacgggcagcggggctggcgccctcgatccacatgaacccggtgttgctgaaa
ccgcaggcgatggtcggctctcaggtggtgctgcgggggcgcgcgctggggaactggccg
gcgcggcattaccacgggctgaaaccgctgctgctgcccgccgtgctggacagctatcgg
cgggtggcggccgaagccgatctggtgctggtcgaaggcgccggatcgggcaccgaaacc
catctgcggcgatccgacatcgccaacatgctgttcgccggggccgccgacctgccggtg
gtgctgctgaccgacaatgaccgcggcggcgccatggcggcggtggtcggaagctggctg
ctgcacacgcccgcagaacgcgcgcgcatccgggggtttctggtcaacaagttccggggc
cagtttgcgctttacgaaccggcctgccgcaccatgacaaatgtcaccggctggcccttt
ctgggtgccgcgcgctggtttgatgcggcggcgttgctgccggccgaagatgcgctggcg
ctggaacggccgggccgcagcgcgggcggggggctggtcatcgccgtgccgcaaatcgac
cgggtggcgaatttcgacgaccttgatccgctgtcagccgagccgggggtggacctgcgc
tgggtgaaacccggccagccgatcccggccaatgcggatgtggtgctgctgcccgggtcg
aagaccacgcggtcggcgcttgaggcgctgcgcaaacagggctgggacatcgacatcctg
gcccatcaccgcaggggcggccgcgtggtgggcatttgtgccggcttccagattctgggc
cgcgtggtacgcgaccccgaggggctggaaggaccggccggcgaaaccgccggcctgggg
ttgcttgaggtggaaacgaccataacccgcgacaagaagctggttgaggtcgcggcgacc
gatgcgcgatcaggcacccgcgtcaccggatatgagatgcacatgggccgcaccaccggc
gcagggctggaccggccctggctgcggctggatggcgtgcccgagggcgccatatcggcg
gatgggcgggtgatgggcggctatatccacggcatcttcggcgccgacggctatcgccgg
cactggctggccgcgatgggcgggcgggcatccggacttgaccatgaggcgcaagtggac
cgcacactggacgctttggccgaccagttggaagccgatctggaccttgatgcccttctg
gccctggcgcgatga

DBGET integrated database retrieval system