KEGG   Rhodobacter blasticus: B6K69_13175Help
Entry
B6K69_13175       CDS       T05669                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00450  Selenocompound metabolism
rbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B6K69_13175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbl03016]
    B6K69_13175
Enzymes [BR:rbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     B6K69_13175
Transfer RNA biogenesis [BR:rbl03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    B6K69_13175
 Prokaryotic type
    B6K69_13175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 AIRS_C AIRS Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWD23507
Position
complement(2697436..2699634)
Genome map
AA seq 732 aa AA seqDB search
MPAAPFPLVRDLVLVGGGHAHALVLRSWAMDPLPGVRLTVINPGPAAPYTGMLPGLIAGH
YTRDEIMIDLVRLARYAGARVILARATGLDLAARCVLLDNRPPLAFDVASVDIGIGSDLP
DIPGYAEHAVAAKPLGHYADAWQAFVARKLPAPRLVILGAGVGGVELALASAHRLRAGGA
EPQITLIERAEAALPNIGRAARATLLRHAQAAGIVFRTGTTATAIGPGTVTLSSGETLPS
DFTLAVAGTQPQPWLAQTGLASQDGFLVVGPTLQTSDPAIFAAGDCAHLSHAPRPKAGVF
AVREAPVLLANLRAALTGGPMRTYHPQRDYLKLVSTGGRGAVADKFGLRSGGGWLWRLKD
RIDRRFMAMFADYPAMPAPALPDPAPQGLAQAMGDKPLCGGCGAKVGPAALRAALASLPA
PQRPDVLSGPGDDAALLRAARGVQALTTDHLRAFTNDPRLMARLAAVHALGDIWAMGAAP
QAALAQITLPRLSEPLQTRTLSDILSEAAQVFRAAGADLVGGHTSTGDELMIGFSVTGLT
DRPVAKAGARPGDAILLTKAIGSGTILAAEMALARVPGLILGEAVVACLTAMARPLGPAA
EILAPVARAMTDVTGFGLAGHLLEMLQASGVSARIDLRAVPMLPGAVMLAGAGQASSLAP
ANRAAIDWLVDAPPGPETDLLFDPQTCGGLLACVPADQADALLARLRAAGDGVAARIGTV
TEGPSKLVVSRS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgccccctttccgctggtgcgcgaccttgtccttgtgggcgggggccatgca
catgcgctggtgctgcggtcctgggcgatggacccgctgcccggcgtgcggctgaccgtc
atcaaccccggccccgccgcgccctataccggcatgttgcccggcctgatcgccggccat
tacacccgggacgagatcatgatcgacctggtccggctggcccgttacgccggggcgcgg
gtgatcctggcgcgcgccaccgggctggacctggccgcccgctgcgtgctgctggacaac
cgcccgccgctggctttcgacgtggcttcggtcgacatcggcatcgggtcggacctgccc
gacattccgggctatgccgagcacgcggtcgcggccaagccgctgggccattacgccgat
gcgtggcaggcgtttgtcgcccgcaagctgcccgcgccacggctggtgatccttggcgcc
ggggtgggcggggtggagctggcgctggcatcggcccaccggctgcgcgccggcggggca
gagccgcagatcaccctgatcgaacgcgccgaggccgcgctgccgaacattggccgcgcc
gcccgcgccacgctgttgcgccacgcgcaggcggccggcattgtctttcgcaccggcacc
accgccaccgccattggccccggcaccgttaccctgtccagcggcgaaaccctgccgtcc
gatttcaccctggccgttgccggcacccagccgcagccctggctggcgcagaccgggctg
gccagccaggacggtttcctggtggtcggccccacgctgcaaacctcggacccggcgatc
tttgcggcgggcgattgcgcccacctgtcccatgccccgcgccccaaggccggcgtcttt
gccgtgcgcgaggcgccggtgctgctggccaacctgcgcgccgcgctgaccggggggccg
atgcggacctaccacccgcagcgcgattacctgaaactggtctcgaccggcggccggggc
gcggtggccgacaagttcggtctgcgcagcgggggcggctggctgtggcggctgaaggac
cggatcgaccgccgcttcatggcgatgttcgccgactatccggcgatgcccgcgccggcg
ctgcccgaccccgcgccgcaggggctggcgcaggcgatgggcgacaagccgctgtgtggc
ggctgcggggccaaggtgggcccggcggcgctgcgggccgcgctggccagcctgcccgcg
ccacagcggcccgatgtgctgtccggccccggtgacgatgccgccctgctgcgcgcggcc
cggggcgtgcaggcgctgacaaccgaccatctgcgcgccttcaccaacgacccgcgactg
atggcccgccttgccgccgttcatgcgcttggcgacatctgggcgatgggggccgcaccg
caggccgcgctggcgcagatcaccctgccccgcctgtcagagccgctgcaaacccgcacc
ctgtctgacattctgtccgaggccgcgcaggtgttccgcgccgccggggctgatctggtg
gggggccatacctcgaccggggacgagctgatgatcggcttctcggtcaccgggctgacc
gaccggccggtcgcaaaggccggcgcccgccccggcgatgcgatcctgctgaccaaggcc
atcggcagcggcaccatcctggccgccgaaatggcgctggcccgtgtgcccggccttatt
ctgggtgaggcggtggtggcttgcctgacggccatggcccggccgctggggcctgcggcg
gaaattcttgcgccggtggcccgggccatgaccgatgtcaccggcttcggtctggcgggg
catctgctggagatgcttcaggcctcgggcgtttcggcccggatcgacctgcgcgccgtg
cccatgctgcccggcgcggtgatgctggccggggcggggcaggcgtccagccttgcgccc
gccaatcgcgccgcgatcgactggctggttgacgccccgcccggccccgaaaccgacctg
ctgttcgatccgcaaacctgcggcggccttctggcctgcgtgccagccgatcaggccgat
gcgttgctggcccggttgcgggcggcgggcgatggcgttgcggcccgcatcggcaccgtc
accgaaggcccatcgaaactggttgtcagccggtcctga

DBGET integrated database retrieval system