KEGG   Rhodobacter blasticus: B6K69_14585Help
Entry
B6K69_14585       CDS       T05669                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00260  Glycine, serine and threonine metabolism
rbl01100  Metabolic pathways
rbl01110  Biosynthesis of secondary metabolites
rbl01120  Microbial metabolism in diverse environments
rbl01130  Biosynthesis of antibiotics
rbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B6K69_14585
Enzymes [BR:rbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B6K69_14585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase ELFV_dehydrog_N PknG_rubred
Motif
Other DBs
NCBI-ProteinID: AWD22752
Position
complement(2991447..2992475)
Genome map
AA seq 342 aa AA seqDB search
MFFASDNSSGAAPEVMAALAAANDGFTRGYGADALTERVQDRLRELFEAPEAAVHLVATG
TAANALALATVAPPWSAIFCHRHAHIAEDECGAPEFYSNGAKLVLVGGDHGKMTPEGLRA
AINATGGSVHGVQRGAVSITNVTEAGTVHTPAEIAALTAEARAFGLPCHLDGARFANALV
ATGATAAEMTWKAGIDLLSFGGTKNGCLGVEAVVIFDPAKAWEFELRRKRGGHLFSKHRY
LAAQMDAYLDGGLWLRLAAQANTAAARLAAGLATIPGVRQTHPVQANMMFPEWPAGTHAR
LQAAGAVYYEMPAPEGREAARLVTSWNTTDADVDRFLTALAG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcgcctctgacaacagctcgggcgcggcgcccgaagtcatggccgcgctggcc
gccgccaatgacggctttacccgcggctacggcgccgatgcgctgaccgaacgggtgcag
gaccggctgcgcgagctgttcgaagcccccgaggcggcggtgcatctggtggcaacggga
accgccgccaatgcgctggccctggcaaccgtggccccgccctggagcgcgatcttctgc
caccggcacgcccatatcgccgaggatgaatgtggcgcgcccgagttctattccaacggc
gccaagctggtgctggtcggcggcgaccatggcaagatgacgcccgaaggcctgcgcgcg
gcgatcaacgccaccggcggcagcgtgcatggcgtgcagcgcggggcggtgtcgattacc
aatgtcaccgaggcggggaccgtccataccccggccgagattgccgcgctgaccgccgag
gcacgggcctttggcctgccctgccatctggacggggccaggttcgccaatgcgctggtg
gcaacgggcgcgacggcggccgagatgacctggaaggccggcattgatctgctgtcgttc
ggaggcaccaagaacggctgtctgggcgtcgaggcggtggtgatcttcgatcccgccaaa
gcctgggaattcgagctgcgccgcaagcgcggcggtcatctcttctcgaaacaccgctat
ctggccgcgcagatggacgcttatcttgacggcggcctctggctgcggctggccgcgcag
gcgaataccgccgccgcgcggctggcggcggggctggccaccatccccggtgttcggcag
acccaccccgttcaggccaacatgatgttccccgaatggcccgccggcacccatgcccgg
ctgcaggccgccggggccgtctattacgagatgcccgcccccgaggggcgcgaggcggcg
cggctggtgacaagctggaacaccaccgacgccgatgtcgaccgctttcttacggctctg
gccggctga

DBGET integrated database retrieval system