KEGG   Rhizobiales bacterium NRL2: TEF_01580Help
Entry
TEF_01580         CDS       T04419                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
rbm  Rhizobiales bacterium NRL2
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TEF_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ANK79627
UniProt: A0A192IEB8
Position
352074..352499
Genome map
AA seq 141 aa AA seqDB search
MASDPTFDSQGRYVAETRGVTVRVKPAYLPRQSDPESGRHVWAYEVTIENGGGETVQLLN
RHWRITDGHGRVEIVEGPGVVGEQPVLQPGQRHTYASGCPLPTPSGIMVGHYEMVNGKGE
RFLVEIPAFSLDLPGGDRAVN
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgacccgacattcgacagccagggccgttacgtcgccgagacccgcggcgtg
accgtgcgcgtcaagccggcctatctgccgcgccagtccgaccccgagagcggccgtcac
gtctgggcctacgaggtcaccatcgagaacggcggcggcgagaccgtgcagcttctcaac
cgccactggcgcatcaccgacggacacggccgcgtcgagatcgtggaaggccccggcgtc
gtgggcgagcagccggtcctgcagcccggccagcgtcacacctatgccagcggctgtccc
ctgccgacgccgagcggaatcatggtcggccactacgagatggtgaacgggaagggcgag
cgcttcctggtcgagattccggccttctccctggatctgccgggcggcgaccgggccgtg
aactag

DBGET integrated database retrieval system