KEGG   Rhizobiales bacterium NRL2: TEF_06685Help
Entry
TEF_06685         CDS       T04419                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbm  Rhizobiales bacterium NRL2
Pathway
rbm00071  Fatty acid degradation
rbm00072  Synthesis and degradation of ketone bodies
rbm00280  Valine, leucine and isoleucine degradation
rbm00310  Lysine degradation
rbm00362  Benzoate degradation
rbm00380  Tryptophan metabolism
rbm00620  Pyruvate metabolism
rbm00630  Glyoxylate and dicarboxylate metabolism
rbm00640  Propanoate metabolism
rbm00650  Butanoate metabolism
rbm00900  Terpenoid backbone biosynthesis
rbm01100  Metabolic pathways
rbm01110  Biosynthesis of secondary metabolites
rbm01120  Microbial metabolism in diverse environments
rbm01130  Biosynthesis of antibiotics
rbm01200  Carbon metabolism
rbm01212  Fatty acid metabolism
rbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TEF_06685
   00630 Glyoxylate and dicarboxylate metabolism
    TEF_06685
   00640 Propanoate metabolism
    TEF_06685
   00650 Butanoate metabolism
    TEF_06685
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TEF_06685
   00072 Synthesis and degradation of ketone bodies
    TEF_06685
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TEF_06685
   00310 Lysine degradation
    TEF_06685
   00380 Tryptophan metabolism
    TEF_06685
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TEF_06685
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TEF_06685
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TEF_06685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbm04147]
    TEF_06685
Enzymes [BR:rbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TEF_06685
Exosome [BR:rbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TEF_06685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: ANK80519
UniProt: A0A192IGX5
Position
complement(1447277..1448812)
Genome map
AA seq 511 aa AA seqDB search
MDETRIPVLVGSGQVTQREEDPRAALSPMDLTAAAGAEAAKDAGVERQVLEALDTVVQLA
SFSDTSWRFTCPFGRYTNPPKSLAARLGATNAKRLVYTHAGGNMTQWCISRMSEMITRGE
LSAAMIAGGEALSTQKAAQRAGVELDWSEDPGGEPERWGVSKRGWSDMEDRHRMAGAIFA
YPLVENAIRGHKGESIDEHLMSMGRLFEGFARVAAANPLADRRDGFTAEQIATVSEKNPF
IGFPYTKLMNANAFIDQSAAVILMSVARAKKLGIPREKWVFLHGCGDANDHWYLSDRINH
WSSPAMRTVGEETCRMAGKSVGDMDFLDLYSCFPSAVQIACAEMGIAEDDPRGLTVTGGL
PYFGGPGNNYVTHSIAEMMNRVRARPGSYGLVTSNGNYVTKQSAGIYSTDMPEKPFAPAD
PATYQARIDAEKGPEVAEFAEGPAEIETYTVMHDRKGPSYAILFGRLEDGRRFIANTPAD
PDLLAEMERTDYLGRAGQVSTADGVNIFVPA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacacgcattccggtcctggtcggctcgggccaggtcacccagcgggaagaa
gaccccagggcggccctgtcgccgatggacctgacagcggccgccggcgcggaggccgcg
aaggacgccggcgtggagcggcaggtgctggaggcgctggacaccgtcgtccagcttgct
tccttctccgacaccagctggcgcttcacctgcccgttcggccgctatacgaacccaccg
aaatcgctcgccgcacggctgggcgcaacgaacgcgaagcggctggtctacacccatgcc
ggcgggaacatgacccagtggtgcatcagccgcatgtcggagatgatcacccgcggcgag
ctctcggccgccatgatcgccggcggggaagcgctgtcgacacagaaggccgcccagcgc
gccggcgtggagctcgactggtcggaggaccccggcggcgagcctgagcgctggggcgtc
tcgaagcgcggctggagcgacatggaagaccgccaccgcatggccggcgcgatcttcgcc
tatccgctggtcgagaacgcaatccgcggccacaagggcgagagcatcgacgagcacctg
atgtccatgggccgcctgttcgaaggcttcgccagggtggcggcggcgaacccgctggcc
gaccgccgcgacggcttcaccgccgaacagatcgccacggtcagcgagaagaaccccttc
atcggcttcccctacacgaagctgatgaacgccaacgccttcatcgaccagtcggccgcc
gtcatcctgatgtcggtggcccgggcgaagaaactgggcatcccgcgggagaagtgggtc
ttcctgcatggttgcggcgacgccaacgaccactggtacctgtcggaccggatcaatcac
tggagctcgccggccatgcgcacggtcggcgaggagacctgccgcatggcgggcaagtcg
gtcggggacatggatttcctcgacctctattcctgcttcccctccgcggtgcagatcgcc
tgcgccgagatggggatcgccgaggacgacccgcgcgggctgacggtgaccggcggcctg
ccctatttcggcggaccggggaacaactacgtcacccactccatcgccgagatgatgaac
cgggtccgcgcccggcccggctcctatggcctcgtcacctccaacggcaactacgtcacc
aagcagtcggcgggaatctactcgaccgatatgccggagaagccgttcgcccccgccgat
ccggcgacctatcaggcgcggatcgacgccgagaaggggccggaagtggccgagttcgcc
gaaggcccggcggagatcgagacctacaccgtgatgcacgaccgcaaggggccgagctac
gcgatcctgttcgggcgcctggaggacgggcggcgcttcatcgccaacacgcccgccgac
ccggatctgctggcggagatggaacggacagactatctgggtcgcgccgggcaggtctcg
accgccgacggcgtcaacatcttcgtgccggcgtga

DBGET integrated database retrieval system