KEGG   Rhizobiales bacterium NRL2: TEF_11500Help
Entry
TEF_11500         CDS       T04419                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rbm  Rhizobiales bacterium NRL2
Pathway
rbm00360  Phenylalanine metabolism
rbm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbm00790  Folate biosynthesis
rbm01100  Metabolic pathways
rbm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    TEF_11500
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TEF_11500
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TEF_11500
Enzymes [BR:rbm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     TEF_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ANK81352
UniProt: A0A192IJ93
Position
complement(2468726..2469511)
Genome map
AA seq 261 aa AA seqDB search
MNDNAVIDQGHDRYTSEDHGVWRTLFERQAKLLPGRAAPEFIEGLDALGVEAGGIPDFER
LSDRLETATNWRIVAVRGLIDDDVFFDHLAHRRFPVTNWIRKPEQLDYLQEPDCFHDCFG
HVPMLFNPVFADYMQAYGQGGLKALEQDALGYLARLYWYTVEFGLIMSEEGLRIYGSGIV
SSKGETLYALESDTPNRLAFDLMRIMQTDYIIDHYQQTYFVIGSYDQLFEATRPDFTPYY
ETLRTRPVIEPHEVLPGDRRV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaatgccgtcatcgatcagggccacgaccgatacaccagcgaggatcacggc
gtctggcgcacgctgttcgagcgccaggcgaaattgctgcccggccgcgcggcgccggag
ttcatcgaaggactggatgcgctgggggtcgaggccggcggcattccggacttcgaacga
ctctccgaccggctggagacggccacgaactggcgcatcgtcgccgtgcgcggcctgatc
gacgacgatgtcttcttcgatcacctcgcccaccgccgcttccccgtcaccaactggatc
cgcaagcccgaacagctcgactacctgcaggaaccggactgcttccacgactgcttcggc
catgtgccgatgctgttcaatccggtcttcgccgactacatgcaggcctatggccagggc
gggctgaaggcgctggagcaggatgcgctgggctatctcgcccggctgtactggtacacg
gtcgaattcggcctgatcatgagcgaggagggcctgcgcatctacggctcgggcatcgtc
tcctcgaagggcgagacgctctacgccctggaaagcgatacgcccaaccgcctcgccttc
gacctcatgcgtatcatgcagaccgactacatcatcgaccattaccagcagacctatttc
gtcatcggttcctacgatcagctcttcgaggcgacacggcccgacttcacgccctattat
gaaacgctcaggacacgtcccgtgatcgagccgcacgaagtgctgcccggcgaccggcgc
gtctga

DBGET integrated database retrieval system