KEGG   Rhizobiales bacterium NRL2: TEF_17830Help
Entry
TEF_17830         CDS       T04419                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
rbm  Rhizobiales bacterium NRL2
Pathway
rbm00670  One carbon pool by folate
rbm01100  Metabolic pathways
rbm01120  Microbial metabolism in diverse environments
rbm01200  Carbon metabolism
Module
rbm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TEF_17830
Enzymes [BR:rbm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     TEF_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: ANK82443
UniProt: A0A192IMI0
Position
complement(3813854..3815530)
Genome map
AA seq 558 aa AA seqDB search
MAHKSDIEIARAATKQPIQEVGARLGIPSEALLPFGHDKAKISQDFINAQKDREDGKLIL
VTAVNPTPAGEGKTTTTVGLGDGLNAIGRKAAICIREASLGPCFGMKGGAAGGGYAQVIP
MEDINLHFTGDFHAITAAHNLLAAMIDNHIHWGNKLGIDARRVAWRRVLDMNDRALRQVV
HSLGGVGNGYPRESGFDITVASEVMAILCLANDLEDLQARLGGIIVAYTRDRKPIYCRDL
KADGAMTVLLKDAMQPNLVQTLENNPAFVHGGPFANIAHGCNSVAATRTALKLADYVVTE
AGFGADLGAEKFFDIKCRKAGLSPDAVVIVATVRAMKMNGGVGKDDLGRENVEAVEKGCA
NLGRHIENVKSFGVPAVVAINHFVTDTEAEIQAVKDYVEWMGSEAIVCRHWAQGSAGITE
LAERVAEIADSGMAQFSPLYPDDMPLFQKIETIAKRIYRADEVLADKKVRDQLRKWEAEG
FGDLPICMAKTQYSFSTDPNLRGAPDGHSVPVREVRLSAGAGFIVVICGEIMTMPGLPRE
PAAEQIMLNDAGEIEGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaagagcgacatcgagatcgcccgcgcggcgacgaaacagcccatccaggaa
gtcggcgcgcggctcggcattccatccgaggcgctgctgcccttcggccatgacaaggcg
aagatcagccaggacttcatcaacgcccagaaggaccgcgaggacggcaagctgatcctg
gtcactgcggtcaacccgaccccggcgggcgagggcaagaccacgaccaccgtgggcctc
ggcgacggcctcaacgccatcggccgcaaggcggcgatctgcatccgcgaggcctcgctc
ggtccgtgcttcggcatgaagggcggcgccgccggcggcggctatgcccaggtgatcccg
atggaggacatcaacctccacttcaccggcgacttccacgccatcaccgccgcgcacaac
ctgctggcggcgatgatcgacaaccacatccactggggcaacaagctgggcatcgacgcc
cgccgcgtcgcctggcggcgtgtgctggacatgaacgaccgcgcgctccgccaggtggtg
cattcgctgggcggcgtcggcaacggctatccgcgcgagagcggcttcgacatcaccgtg
gcctccgaggtcatggcgatcctctgcctggccaacgacctggaggatctgcaggcgcgg
ctgggcggcatcatcgtcgcctacacccgcgaccggaagccgatctattgccgcgacctg
aaggccgacggcgccatgacggtgctgctgaaggacgccatgcagccgaacctggtgcag
acgctggagaacaatcccgccttcgtccacggcgggccgttcgccaacatcgcccatggc
tgcaactccgtcgccgccacccgcacggcgctgaagctggctgattacgtcgtcaccgag
gccggtttcggcgcggacctgggcgccgagaagttcttcgacatcaagtgccgcaaggcc
ggtctgtcgcctgacgccgtggtcatcgtcgccacagtgcgtgcgatgaagatgaacggc
ggcgtcggcaaggacgacctgggccgggagaacgtcgaggcggtcgagaagggctgcgcc
aatctgggccgccacatcgagaacgtgaagtccttcggcgtgccggccgtggtcgcgatc
aaccacttcgtcaccgacaccgaggccgagatccaggcggtgaaggactatgtcgaatgg
atgggctccgaggctatcgtctgccgccactgggctcagggttcggcaggaatcacggaa
ctggccgagcgcgtggccgagatcgccgacagcggcatggcgcagttcagcccgctctat
cccgacgacatgccgctgttccagaagatcgagaccatcgccaagcgcatctaccgcgcc
gacgaggtgctggccgacaagaaggtccgcgaccagctgcgcaagtgggaggccgagggc
ttcggcgacctgccgatctgcatggccaagacccagtacagcttctcgaccgacccgaac
ctgcgcggggcgcccgacggccattccgtgccggtccgggaggtcaggctatcggccggc
gccggtttcatcgtggtgatctgcggcgagatcatgacgatgcccggcctgcctcgggaa
ccggcggccgagcagatcatgctcaacgacgccggcgagatcgaagggctgttctag

DBGET integrated database retrieval system