KEGG   Rubrivivax benzoatilyticus: RBXJA2T_02140Help
Entry
RBXJA2T_02140     CDS       T04092                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RBXJA2T_02140 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbn03011]
    RBXJA2T_02140 (rplV)
Ribosome [BR:rbn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RBXJA2T_02140 (rplV)
  Bacteria
    RBXJA2T_02140 (rplV)
  Archaea
    RBXJA2T_02140 (rplV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: EGJ09095
UniProt: F3LL77
AA seq 109 aa AA seqDB search
METKAIVRGVRLSADKGRLVADMIRGKKVDQAINILTFTPKKAAVIIKKAVESAVANAEH
NDGADIDELKIKSIYVEQGATLKRFSARAKGRGNRISKPTCHIFVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaggcaatcgtccgcggtgtgcgcctctcggccgacaagggtcggctggtg
gcggacatgatccgcggcaagaaggtcgaccaggcgatcaacatcctcacgttcacgccg
aagaaggcggccgtcatcatcaagaaggcggtcgaatcggcggtggccaacgcggagcac
aacgacggtgcggacatcgacgagctgaagatcaagtcgatctacgtcgagcaaggcgcc
acgctgaagcgtttctcggcccgtgcgaagggtcgcggcaaccgcatcagcaagccgacc
tgccacatcttcgtgaccgtcggcaactga

DBGET integrated database retrieval system