KEGG   Rubrivivax benzoatilyticus: RBXJA2T_05008Help
Entry
RBXJA2T_05008     CDS       T04092                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00071  Fatty acid degradation
rbn00072  Synthesis and degradation of ketone bodies
rbn00280  Valine, leucine and isoleucine degradation
rbn00310  Lysine degradation
rbn00362  Benzoate degradation
rbn00380  Tryptophan metabolism
rbn00620  Pyruvate metabolism
rbn00630  Glyoxylate and dicarboxylate metabolism
rbn00640  Propanoate metabolism
rbn00650  Butanoate metabolism
rbn00900  Terpenoid backbone biosynthesis
rbn01100  Metabolic pathways
rbn01110  Biosynthesis of secondary metabolites
rbn01120  Microbial metabolism in diverse environments
rbn01130  Biosynthesis of antibiotics
rbn01200  Carbon metabolism
rbn01212  Fatty acid metabolism
rbn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBXJA2T_05008
   00630 Glyoxylate and dicarboxylate metabolism
    RBXJA2T_05008
   00640 Propanoate metabolism
    RBXJA2T_05008
   00650 Butanoate metabolism
    RBXJA2T_05008
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBXJA2T_05008
   00072 Synthesis and degradation of ketone bodies
    RBXJA2T_05008
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBXJA2T_05008
   00310 Lysine degradation
    RBXJA2T_05008
   00380 Tryptophan metabolism
    RBXJA2T_05008
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBXJA2T_05008
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBXJA2T_05008
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBXJA2T_05008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbn04147]
    RBXJA2T_05008
Enzymes [BR:rbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RBXJA2T_05008
Exosome [BR:rbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBXJA2T_05008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: EGJ09663
UniProt: F3LMU5
AA seq 393 aa AA seqDB search
MAEAFIVAALRTPCGRRNGRLSGWHPADLAAQVIDALVARSGVDPAAVDDVILGCVGQVG
EQAANVARNAVLASSLPESVPGTTVDRQCGSSQQALHFAAQAVMSGTMDCVIAGGVESMS
RVPMGLPMELPRQAGYGHYVGPAIAARYPGAEFSQFTGAEMLATKYGLAKPALDAWALQS
HQRAAAATRDGAFAAEILPLAVRRADGSGEAEPLAADEGIRADASAESISGVRLLREGGS
ITAANASQIADGASGVLVVNERGLKALGLPPLARIHTMTVIGHDPVIMLEAPIPATAVAL
QKAGLALDDIDCFEVNEAFASVPLAWLQATGADPARLNVHGGAIALGHPLGASGTRLMAT
LLHTLRRRGGRWGLQTMCEGGGLANVTIVERLS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagccttcatcgtcgccgcgctgcgcaccccgtgcggccggcgcaacggccgt
ttgagcggctggcatccggccgacctggcggcgcaggtcatcgacgcgctggtcgcgcgc
tccggcgtcgacccggcggcggtcgacgacgtcatcctcggctgcgtcggccaggtcggc
gagcaggcggccaacgtcgcacgcaacgcggtgctggcttcgtcgctacccgagtcggtg
ccgggcacgacggtcgaccgccagtgcggctcgtcgcagcaggcgctgcatttcgccgcc
caggcggtgatgtcgggcacgatggactgcgtcatcgccggcggcgtcgagagcatgtcg
cgcgtgccgatgggtctgccgatggagctgccgcgccaggccggctacggccactacgtc
ggcccggcgatcgccgcgcgttacccgggtgccgagttcagccagttcaccggcgccgag
atgctggccacgaagtacggcctggcgaaaccggcgctggacgcctgggcgctgcagagc
caccagcgcgccgcggccgccacgcgcgacggcgcgttcgccgccgagatcctgccgctg
gccgtgcgccgcgccgacggcagcggcgaggccgagcccttggccgccgacgaaggcatc
cgcgccgacgccagcgccgagagcatctccggcgtgcgcctgctgcgcgaaggcggcagc
atcaccgccgccaatgccagccagatcgccgacggcgccagcggcgtgctggtggtcaac
gaacgcggcctgaaggcgctgggcctgccgccgctggcgcgcatccacacgatgaccgtc
atcggccacgacccggtgatcatgctggaggcgccgatcccggccaccgcggtggcgctg
cagaaggccgggctggcgctggacgacatcgactgcttcgaggtcaacgaggccttcgcc
tcggtgccgctggcctggctgcaggccaccggcgccgacccggcgcggctcaacgtgcac
ggcggcgcgatcgcgctcggccacccgctgggcgcctcgggcacccggctgatggcgacg
ctgctgcacacgctgcgccgccgcggcgggcgctgggggctgcagacgatgtgcgaaggc
ggcggcctggccaacgtcaccatcgtggagcgtttgtcgtga

DBGET integrated database retrieval system