KEGG   Rubrivivax benzoatilyticus: RBXJA2T_09432Help
Entry
RBXJA2T_09432     CDS       T04092                                 

Definition
(GenBank) O-methyltransferase family protein
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00906  Carotenoid biosynthesis
rbn01100  Metabolic pathways
rbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    RBXJA2T_09432
Enzymes [BR:rbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     RBXJA2T_09432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_23 Methyltransf_25 Methyltransf_12 HTH_20 Methyltransf_24 Sigma70_r4 MTS
Motif
Other DBs
NCBI-ProteinID: EGJ10537
UniProt: F3LQB9
AA seq 390 aa AA seqDB search
MDRAETRPQAGPRRSPTLAERFRDWKHRTIARPGFQKWAAAFPLTRPVARKHARELFDLL
AGFVYSQILLACVRLDVFRMLADGPLPLATVAERCGLSLEATRRLVAAADSLELLDLQSG
DLVTLGRLGAPLVANEAITAMVEHHATLYGDLTDPVALLRGQGRPAMAGYWPYAAAADAG
PGLPATLATEKVAEYSKLMTASQPLVAREVIAAYRFGRHKVLMDVGGGEGAFVRCVAAEV
PGVELRVFDLPAVAERANENFRRWGLAGRAQAFGGDFFADELPRGADVISLVRVAFDHPD
ERVLTLFKNVRRALPDNGTLVLAEAMAEVPGVEPIGDAYFGFYLLAMGRGRPRSAARLTQ
LLHEAGFASVRSLPTHMPLQAGVLVARCTA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaccgagccgagacgaggccgcaggccgggccgcgccgttccccgacgctggccgaa
cgctttcgcgactggaagcaccgcacgatcgcccgccccgggttccagaagtgggccgcg
gccttcccgctgacccgcccggtggcgcgcaagcacgcccgcgagctcttcgacctgctg
gcgggcttcgtctattcgcagatcctgctggcctgcgtgcgcctggacgtgttccgcatg
ctggccgacggcccgctgccgctggccaccgtcgccgagcgctgcggcctgagcctggag
gcgacacgtcgcctggtggcggctgccgactcgctcgagctgctggacctgcagagcggg
gacctcgtcacgctggggcgcctgggtgcgccgctggtcgccaacgaggcgatcacggcg
atggtcgagcaccacgcgacgctgtacggcgacctgaccgaccccgtggcgctgctgcgc
ggccaggggcgtccggcgatggccggctactggccgtatgccgcggccgccgatgccggc
cccggcctgccggcgacgctggccaccgagaaggtcgccgagtactccaagctgatgacg
gcctcgcagccgctggtggcgcgcgaggtcatcgccgcctaccgcttcggccggcacaag
gtgctgatggacgtcggtggcggcgagggcgctttcgtgcgctgcgtggccgccgaggtg
ccgggtgtcgagctgcgggtcttcgacctgccggccgtcgccgagcgtgccaacgagaac
ttccggcgctggggtctggccggccgcgcccaggctttcggcggcgacttcttcgccgac
gagctgccgcgtggtgccgacgtgatctccctcgtccgcgtggccttcgaccatccggat
gaacgggtgttgacgctgttcaagaacgtgcgccgggccttgccggacaacggcacgctc
gtgctcgccgaggcgatggccgaggtgcccggcgtcgagccgatcggcgacgcgtacttc
ggcttctacctgctcgcgatgggccgcggccgtccgcgttcggcggcccgcctgacgcag
ctgctgcacgaagccggcttcgccagcgtccgttccctgcccacgcacatgccgctgcag
gcgggtgtcctggtggcgcgctgcactgcttaa

DBGET integrated database retrieval system