KEGG   Rubrivivax benzoatilyticus: RBXJA2T_09542Help
Entry
RBXJA2T_09542     CDS       T04092                                 

Definition
(GenBank) Mg-protoporphyrin IX methyl transferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00860  Porphyrin and chlorophyll metabolism
rbn01100  Metabolic pathways
rbn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RBXJA2T_09542
Enzymes [BR:rbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     RBXJA2T_09542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 Cons_hypoth95 MTS CMAS Methyltransf_2 TPMT PCMT PrmA Ubie_methyltran Methyltransf_9 baeRF_family10 TehB Methyltransf_18 NodS Methyltransf_15 RrnaAD FtsJ
Motif
Other DBs
NCBI-ProteinID: EGJ10559
UniProt: F3LQE1
AA seq 233 aa AA seqDB search
MDNTSYQNRRGEVEHYFDRTAAQTWARLTSDAPVSGVRATVRAGRDRMRTTLLSWLPQDL
RGRRVLDAGCGTGAASIELARRGAEVVAIDLSPTLVGYARERLPESLGPGSIDFRSGDML
DAALGRFDHVIAMDSVIHYDAPDAVAALSRLAERTSTSMVFTFAPRTALLSLMWTVGKLF
PRGDRSPAIVPVAPDQLRALMAAHPGLKDWQWGRSERVASGFYTSQATEWKRS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaccagctatcagaaccgccgcggcgaggtcgagcactacttcgaccgcacc
gccgcccagacctgggcgcggctgacgtccgacgccccggtcagcggcgtgcgcgccacc
gtgcgcgccggccgcgaccgcatgcgcacgacgctgctgtcgtggctgccgcaggacctg
cgcggccggcgtgtgctcgacgcaggctgcggcaccggcgcggcctcgatcgaactcgcg
cgccgcggcgccgaggtcgtcgcgatcgacctgtcgccgacgctggtcggctacgcccgc
gagcgcctgcccgagtcgctgggtccgggctcgatcgacttccgcagcggcgacatgctc
gatgcggcgctgggccgcttcgaccacgtcatcgcgatggactcggtgatccactacgac
gcgccggacgccgtcgcggcgctgtcgcggctcgccgagcgcacctcgacctcgatggtc
ttcaccttcgcgccgcgcaccgcgctgctgtcgctgatgtggaccgtcggcaagctgttc
cctcgcggtgaccgctcgccggccatcgtgccggtcgcgcccgaccagttgcgtgcgctg
atggccgcgcaccccgggctgaaggactggcagtggggccgcagcgaacgcgtcgccagc
ggcttctacacctcccaggccacggagtggaaacgctcgtga

DBGET integrated database retrieval system