KEGG   Rubrivivax benzoatilyticus: RBXJA2T_11653Help
Entry
RBXJA2T_11653     CDS       T04092                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00130  Ubiquinone and other terpenoid-quinone biosynthesis
rbn00627  Aminobenzoate degradation
rbn01100  Metabolic pathways
rbn01110  Biosynthesis of secondary metabolites
rbn01120  Microbial metabolism in diverse environments
rbn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    RBXJA2T_11653
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RBXJA2T_11653
Enzymes [BR:rbn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     RBXJA2T_11653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein DUF4226
Motif
Other DBs
NCBI-ProteinID: EGJ10978
UniProt: F3LRL0
AA seq 188 aa AA seqDB search
MPHQRLVVGITGASGAVYGVRLLERARALGVETHLVATPAGVLNAHHELGLSRGDLEALA
DHSYAPGDVGACVASGSFGTSAMVVAPCSMKTLAAVAHGLADNLLTRAADVALKERRRLV
LMVRETPLNLAHLRNMTAATEMGAIVFPPLPAFYHRPQTVAEIVDDGVERVLSLLQLDGA
TPREWRGL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaccagcggctcgtcgtcggcatcaccggcgccagcggcgccgtctacggcgtg
cggctgctggagcgcgcgcgggcgctgggcgtcgagacccacctggtggcgacgccggcc
ggcgtgctcaacgcccaccacgagctgggcctgtcgcgcggcgacctcgaggcgctggcc
gaccactcgtacgcgcccggcgacgtcggcgcctgtgtcgccagcggcagcttcggcacc
tcggcgatggtcgtcgcgccgtgctcgatgaagacgctggccgcggtcgcccacggcctg
gccgacaacctgctgacacgtgccgccgacgtcgcgctgaaggagcgccggcgcctcgtg
ctgatggtgcgcgagacgccgctgaacctggcgcacctgcgcaacatgacggccgccacc
gagatgggcgcgatcgtcttcccgccgctgccggccttctaccaccggccacagacggtg
gccgagatcgtcgacgacggcgtcgagcgcgtgctctcgctgctgcagctcgacggcgcg
acaccgcgcgagtggcgcggcctgtag

DBGET integrated database retrieval system