KEGG   Rickettsia bellii OSU 85-389: A1I_00830Help
Entry
A1I_00830         CDS       T00602                                 

Definition
(GenBank) EMAP domain containing protein
  KO
K06878  tRNA-binding protein
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    A1I_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_bind
Motif
Other DBs
NCBI-ProteinID: ABV78566
Position
153800..154132
Genome map
AA seq 110 aa AA seqDB search
MITYKEFENVELRSGTITKIEEFPRAKKPAFKVLADFGAEIGTLQTSAQITKHYTSQELI
GKSIVGCVNLGEKNIAGFLSQFLLVGFPDSNNDICLVTIDPKVPNGQKLC
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgataacctacaaagaatttgagaatgttgagttacgttcagggacaattaccaaaata
gaagagtttccaagagccaaaaagccggcatttaaagttttggcagattttggtgcagaa
attggaactttgcaaacatccgcacaaataacaaaacattatacctctcaagaattaata
ggcaaatccatagttggctgtgtaaatttaggagaaaagaatatagccggcttcttatct
cagtttttattagtaggatttcctgattctaataacgatatatgtttagtcacgattgac
cctaaagtacctaacggtcaaaaattgtgttga

DBGET integrated database retrieval system