KEGG   Rickettsia bellii OSU 85-389: A1I_00835Help
Entry
A1I_00835         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABV78567
Position
154129..154740
Genome map
AA seq 203 aa AA seqDB search
MKPKNIFSSICFISIFLFILLWQDLKINNEVAEDIGNCLYKSNYKNLELNSREGDFNISY
IPNAPRNCFNPSFPIIHIKLKQEHNAWLQIVRTDSSDKKLQKFIDTNLELHPFYTLEQDF
YDAPLWYYTLFSKPLTYWTAHTYAVKIDNQNKTIKIIGGIKWGFRLAYFPIKPQMILPSS
LDTNDWQVDVEVFKQALVGYKID
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacctaaaaatatttttagctcaatctgtttcatcagtatattcttatttatttta
ctttggcaggaccttaagataaataatgaagtagctgaagatataggaaactgtttatac
aaaagtaattataagaatcttgagcttaattctagggaaggagattttaacatttcctat
atcccgaatgctccaagaaattgttttaatccatcttttcctattattcatattaagctt
aagcaagagcataatgcttggcttcagattgttcgcactgattcttcagataaaaaatta
caaaaatttatagatactaatctagaattacatcctttttatactttggagcaagatttc
tacgatgctcctttatggtactatacacttttttctaagccgttaacttattggactgcc
catacttatgcagtgaaaatagataatcaaaataaaactataaaaattattgggggaatt
aaatggggatttaggttagcttattttcctattaaacctcaaatgattctaccctctagc
cttgataccaacgattggcaggtagatgtagaagtttttaaacaagcgttagttgggtat
aaaatagattaa

DBGET integrated database retrieval system