KEGG   Rickettsia bellii OSU 85-389: A1I_00860Help
Entry
A1I_00860         CDS       T00602                                 

Definition
(GenBank) Ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00030  Pentose phosphate pathway
rbo00230  Purine metabolism
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
rbo01230  Biosynthesis of amino acids
Module
rbo_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A1I_00860
  Nucleotide metabolism
   00230 Purine metabolism
    A1I_00860
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     A1I_00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ABV78572
Position
complement(158060..158905)
Genome map
AA seq 281 aa AA seqDB search
MKIIADSSNKLLATRLAITLNIKYIEPKITYFSDSEIKLEIQEPLHNEDIIIVQSTSKPI
NDRLIELFLLIDTAKKVGANKIILVMPYFGYARQDKISNQAAMPAQLIANFLEKLGVTHL
ITIDLHSDKIERFFNIPVSNLKPIELYLPFLQNYKNCIIVAPDKGSINKVESIGNLLNVD
LAYITKERDVNNSCNMVEITGNVEGKNCILIDDIIDSGETIYKAANFLKQHGALSVNAFI
THAVLSKNYDIALLDRIFVTDTIETDDLSSKFHIIPIYCLS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatagccgacagtagtaataagctacttgcaactcgtttagctataacatta
aatatcaaatatattgaacctaaaatcacttattttagtgactcagaaataaaattagaa
attcaagaaccactacataatgaagatatcatcatagtacaatccacttcaaaacctatt
aatgatcgtttaattgagctatttttacttatagatactgcaaaaaaagtaggagcaaat
aaaataattttagtaatgccttattttggttatgcaaggcaagataaaatatcaaatcaa
gctgctatgccagcacaattaatagctaattttctagaaaaattaggagtaactcactta
attaccattgatttgcattctgataaaatagaaagattttttaatattccggtttctaat
ctcaaacctatcgaattatatttaccatttttgcaaaattataaaaattgtattatagtt
gcccctgataaaggaagcattaataaggtagaatccattggaaacttgttaaacgtagat
ttagcctatataaccaaagaaagagatgttaataatagctgcaatatggtagaaataaca
gggaatgttgagggcaaaaattgtatattaattgatgatattatcgatagtggtgaaact
atttataaagctgctaattttttaaagcagcatggagctttatcggtaaatgcttttatt
acgcatgctgtactttcaaaaaattatgatatcgcattattggatcgtatttttgttact
gatactatagaaacagatgacttatcttctaaatttcatataatacctatatattgccta
tcttag

DBGET integrated database retrieval system