KEGG   Rickettsia bellii OSU 85-389: A1I_00875Help
Entry
A1I_00875         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
  KO
K09778  uncharacterized protein
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    A1I_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF374 LEF-9
Motif
Other DBs
NCBI-ProteinID: ABV78575
Position
complement(161396..162052)
Genome map
AA seq 218 aa AA seqDB search
MRKAFKKFLKRNKFVLSLITILLYWYLRFVYFTSKQKFIFYDDGNKEKFLNEQGVIFAFW
HNMLALSPAMFKGMPDVYALISPHLDGKILNDLVDKFGCKVIVGSSNKNPLGALRNIIEK
LSQGANVIITPDGPKGPVYRVNSGITEIAYKYNKKLIPVVSTTSRCFRLKSWDKLIIPLP
FGTIKVIIGSPLELTDNKVQNHMNLEKYLVNLTENLIK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagcttttaaaaaatttttaaaacgtaataaatttgtccttagtttaattact
attttactatattggtatttgcgttttgtttattttacttcaaagcagaaatttatattc
tatgacgatggcaataaggaaaagtttttaaatgagcaaggcgtaatttttgcattttgg
cataatatgcttgcattaagtcctgctatgtttaaaggaatgccagatgtctacgcatta
atatccccacatttagatggcaagatattaaatgatttagtcgataaatttggctgcaaa
gttatagtcggttctagcaataaaaatccacttggggcattgcggaatattatcgaaaag
ctttctcaaggtgcaaatgtaataattacgcctgatggtcctaaaggtcctgtatataga
gtaaatagcggaattactgaaattgcttataaatacaataaaaaattaattccggtagtc
agtactacttctagatgttttaggttaaaaagctgggataagttgataatccctttgcca
tttggtacgattaaagtaataatagggtcacctttagagctgaccgacaataaagtacaa
aatcatatgaatcttgaaaaatatttagttaatttaactgagaacttaataaaatga

DBGET integrated database retrieval system