KEGG   Rickettsia bellii OSU 85-389: A1I_00880Help
Entry
A1I_00880         CDS       T00602                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00220  Arginine biosynthesis
rbo00250  Alanine, aspartate and glutamate metabolism
rbo00270  Cysteine and methionine metabolism
rbo00350  Tyrosine metabolism
rbo00360  Phenylalanine metabolism
rbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01130  Biosynthesis of antibiotics
rbo01210  2-Oxocarboxylic acid metabolism
rbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A1I_00880
   00270 Cysteine and methionine metabolism
    A1I_00880
   00220 Arginine biosynthesis
    A1I_00880
   00330 Arginine and proline metabolism
    A1I_00880
   00350 Tyrosine metabolism
    A1I_00880
   00360 Phenylalanine metabolism
    A1I_00880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A1I_00880
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    A1I_00880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rbo01007]
    A1I_00880
Enzymes [BR:rbo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     A1I_00880
Amino acid related enzymes [BR:rbo01007]
 Aminotransferase (transaminase)
  Class I
   A1I_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: ABV78576
Position
complement(162214..163413)
Genome map
AA seq 399 aa AA seqDB search
MSIISTRLNAIKPSPTLAVVRKTLELKRAGIDIIALGAGEPDFDTPDNIKEAAIKAIKDG
FTKYTNVEGIPALKEAIQAKFKRENNIDYDLEEIIVSTGGKQVIYNLFMASLNKGDEVII
PAPYWVSYPDMVLLAEGTPVFTNCGIESNFKLSGEALEQLITPKTKWLIINSPSNPTGAS
YSHSELKNIAEVLRKHPYVNVMSDDIYEHITFDGFKFYTLAEIAPDLKDRIFTVNGVSKA
YSMTGWRIGYGAGSKALIKAMTIIQSQSTSNPCSISQVAAVEALNGVQGYIAQNALNFEK
KRDLALSILQRVKYFECYKPEGAFYLFIKCDKIFGAKTKSGKVINNSNDFGEYLLEEAKV
AVVPGIAFGLEGYFRISYATSMEELEEACLRMERACGSL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattatttctacgcgattaaatgctataaaaccatctccgacgcttgcagtagtt
aggaaaacgctcgagcttaaaagagcgggtattgatattattgcacttggggcaggtgag
cctgattttgatacgcctgataatatcaaagaagcagccatcaaagccattaaagatggg
tttactaaatatacaaacgttgaggggataccagctttaaaagaagcaatacaagctaaa
tttaaacgagaaaataatatagattatgatcttgaggaaataatagttagcaccggcggc
aagcaagttatatataatttatttatggcatctttaaataaaggggatgaggttattatt
cctgctccttattgggtgtcctatcccgatatggttttacttgctgaaggtactccggtt
tttacaaattgcggtattgaaagtaactttaaactaagcggtgaggctttagagcagtta
attacgcctaaaactaaatggcttattattaattcacctagtaatccaacaggtgcaagc
tatagccattcagagttaaaaaatattgctgaagttctaagaaagcatccgtatgtaaac
gtcatgtctgatgatatttatgagcatattacttttgatggttttaaattttatacttta
gcagaaatagcacctgatttaaaagatcggatatttactgttaatggcgtatccaaagca
tattctatgacaggttggcgtataggttatggtgcaggttcgaaagctttaattaaagct
atgactattattcagtcacaaagtacttcaaacccgtgttcaataagccaagtagcagcc
gttgaggcactaaatggcgtgcaaggctatattgcacaaaatgctttaaattttgagaaa
aaacgtgatcttgctttatcgattctacaaagagtgaaatattttgaatgctataaacct
gagggggctttttacttatttattaaatgtgataagatttttggagctaaaactaaatca
ggaaaagtaattaataatagtaatgatttcggtgaatatttacttgaagaagcaaaagtc
gctgtagtccctggtattgcttttggcttagaaggatatttcaggatttcctatgctact
tctatggaagagctggaagaggcttgtttgcgtatggagcgggcttgtggttcattatag

DBGET integrated database retrieval system