KEGG   Rickettsia bellii OSU 85-389: A1I_00895Help
Entry
A1I_00895         CDS       T00602                                 

Definition
(GenBank) VacJ lipoprotein precursor
  KO
K04754  phospholipid-binding lipoprotein MlaA
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    A1I_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaA
Motif
Other DBs
NCBI-ProteinID: ABV78579
Position
164708..165475
Genome map
AA seq 255 aa AA seqDB search
MRILIILSIILCSLFTKADLEYVDDDIYNYNGSSNINGCREVYDPYEKFNRKIFAFNSVL
DYIFLRPLAVGYKNLTNDYMKARVNSFVGNIDMPLTAVNYGLQLNYDKTMKSVWRFIINT
TLGIGGLFDVAGKVGLSSDRQTFGNTLAHYGVGPGPYLVLPIIGSTNARDMTDPIFTNYA
LNPLMYYTHKDFELSVLAVSKINDRYNVLSFSDYVMKNSLDPYATIRSALHQAREASVQY
PKNFKCPKPKNVNSN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaatactaattatactttcgattatcctatgttcattattcacgaaagccgatctt
gaatatgtagatgatgacatatacaactataatggtagcagtaatattaatggttgccga
gaagtttacgatccatacgaaaaatttaaccgtaaaatttttgcttttaactcagtatta
gattatatattcttacgtcctttagctgttgggtataaaaaccttacaaatgattatatg
aaagcaagggttaatagttttgttggtaatattgatatgccacttactgctgtaaattat
gggttgcagcttaattacgataagactatgaaaagcgtatggcggtttatcattaacaca
acgcttggtataggtggtttatttgacgtagcaggtaaagtagggctgtcatcagatcgc
cagacttttggtaatactcttgcacattatggagtaggtccaggtccttatttggtgtta
ccgataataggtagtactaatgcaagggatatgactgacccaatatttactaattatgca
cttaatcctttaatgtattatacccataaagattttgaattaagtgttttagcggtgagt
aaaataaatgatagatataatgtattatcatttagtgattatgttatgaagaattcgtta
gacccttatgctactatcagatcggcattacaccaagctcgtgaagcatctgttcaatat
cctaaaaactttaaatgtcctaaacctaaaaacgtaaattctaattaa

DBGET integrated database retrieval system