KEGG   Rickettsia bellii OSU 85-389: A1I_00900Help
Entry
A1I_00900         CDS       T00602                                 

Definition
(GenBank) ABC-type transporter
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo02010  ABC transporters
Module
rbo_M00210  Phospholipid transport system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A1I_00900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbo02000]
    A1I_00900
Transporters [BR:rbo02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter [MD:M00210]
    A1I_00900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MlaC Con-6
Motif
Other DBs
NCBI-ProteinID: ABV78580
Position
165487..166071
Genome map
AA seq 194 aa AA seqDB search
MQKIITSLFLLIFTFSSYADDNAPAGLNDYVTNLVNEASTTLNNPNLSQDAKVAKARELM
HNNLDFDWMARYTLGRNGVQTLSKEQIAKFTEVYSKYVTKAYTDLIKDYKGEKPQVTGVH
VLSPKDSMVSMNINNKGQDIKVEYLVRKMENGKFKVSDVITEGVSLIGAQQQDFTSTLKD
QGFDALVQSLQSRS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaattattactagcttatttttattgatttttacattttcttcttatgcagac
gataatgcccccgcaggtttaaatgattatgttactaacttagtaaatgaagcttctact
actttaaataatcctaacctatctcaagatgcaaaagttgccaaagcacgtgaactaatg
cataataatctagattttgactggatggctaggtatacattaggacgtaacggagtacaa
actttatctaaggaacaaattgcaaagtttacagaagtttattctaaatatgttactaaa
gcttatactgatctaataaaagattacaaaggtgaaaaacctcaagtaacaggagtgcat
gttctaagcccaaaagattctatggttagcatgaatattaataataaaggacaggatatt
aaagtagaatatttagtgcgtaaaatggaaaatggaaaattcaaagtttccgacgttatt
acagaaggtgtaagtcttattggtgctcaacaacaagattttacttcgactctaaaagat
caaggttttgatgctttagtgcaaagcctacaaagccgttcataa

DBGET integrated database retrieval system