KEGG   Rickettsia bellii OSU 85-389: A1I_00930Help
Entry
A1I_00930         CDS       T00602                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase RluD subfamily protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rbo03009]
    A1I_00930
Enzymes [BR:rbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     A1I_00930
Ribosome biogenesis [BR:rbo03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    A1I_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: ABV78586
Position
complement(169913..170851)
Genome map
AA seq 312 aa AA seqDB search
MLEYSVPTELSGLRLDKALSQLLENVSRNQIQKAIKSSCVQINNVIILDSDILVKENDII
LFSFKEPEELTIEAADIKLDIVYEDEDLIVINKAAGMTVHPGAGHHDDTLVNALLHHTRN
LSDIGSSERPGIVHRLDKDTTGLMVVAKNNKAHMLLANQIEQRQVVRKYKALVWGVINPL
EGTIKNNIGRSRSDRQKMTILKYGGKEAVTYYKTLELFYGGSISMVECKLATGRTHQIRV
QLSHLKHSVVGDQIYGNNDRKINHAPPELKAKLLDFKRQALHSWYLSFTHPTSNEVMEFS
CELPKDMEGVIK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatactctgtacctactgaactaagcggcttaaggcttgataaagctttatct
caacttcttgaaaatgtctcacgcaatcagattcaaaaagcaattaaaagttcttgtgta
caaattaacaatgtgattattctcgattctgatattttggtcaaggagaatgatattata
ttattttctttcaaagaaccagaagagctaacaatcgaggcagctgatataaaacttgat
atagtttatgaagatgaagatttaatagttatcaacaaagctgccggtatgactgtccac
ccaggagcagggcaccatgacgatacgcttgttaatgccctactccaccacacaagaaat
ttatctgatatcggctcatcagaaagacctggcatagtgcatcgtttagataaggacaca
acgggcttgatggtggttgctaaaaataataaagcacatatgttgcttgccaatcagatt
gaacaaaggcaggtcgtacggaaatataaggctttagtttggggcgtaattaatccgcta
gagggaactattaagaataatataggtcgcagtcgaagcgatcggcaaaaaatgacaata
ttaaaatatggcgggaaagaggccgtgacctactacaaaactctagaactattttatgga
ggtagtattagtatggtagaatgtaagcttgctaccggcagaactcatcagattagagtg
cagctaagccatttaaagcactcggtggttggtgatcaaatatatggtaataacgaccga
aaaattaaccatgctccgcctgaactaaaggcaaaattattagattttaaacgccaagcc
ctgcattcttggtatttaagctttacccatccaaccagtaatgaagttatggaattttct
tgtgaactaccaaaggacatggagggggttattaaataa

DBGET integrated database retrieval system