KEGG   Rickettsia bellii OSU 85-389: A1I_00980Help
Entry
A1I_00980         CDS       T00602                                 

Definition
(GenBank) VirB6
  KO
K03201  type IV secretion system protein VirB6
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo03070  Bacterial secretion system
Module
rbo_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1I_00980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbo02044]
    A1I_00980
Secretion system [BR:rbo02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   A1I_00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ABV78594
Position
186614..190087
Genome map
AA seq 1157 aa AA seqDB search
MNRNIFITLLISLLALSGCSGDTCIDPDDFGFIKFNISSRYDPSEVTSRQEGDQVAPWRD
SAYKVNGYPLTIMVRPWDYMSGDKNTSGMLSAWCPWYGQQNNFTTLAEFCVRLRPCQFTD
GKMCPTPTPRDAPINNAPCILTNGVGLYFLIADKGSNPNMSPDSQRSPKGITQHLGEPVA
SQDYEFYSISSTGKFLQAGGINYQYGCTSLPCDQASNYAQSSLYFKILDKFYDDNSGQYR
VVIKSGVSDTRPDPLQFLTNLIKNELFGTSDKDPGIVRQTYQQIIETPGYRLSVSALLTL
YIMFTGFSFLIGNINMTHVELVVRILKVSVVSILLSTSKAWTFFHDYLFVFFVEGLAQIL
QIVQDASTGQSLLSLLISPQTLSKLFSLLFVDPLGFIYIILYLIALYFIFLLIFKATIIY
LTALITIGMIITMAPIFICFMLFNITRSLFENWLRQLISYAIQPIILFVGIAFIGMIIKT
EIQSTLGFAVCKKDFPDLGPINQIFGSFTEDLDSSIGNSIFYWWFPVPMKGGIENFTQAD
ILVPEDYTKKDGTKCLAYQCIDKRYIQLPFLDLVKDANRISNFINGKFVQLDGLLLIFVS
IYLLSKFNDTAISTASFIAGTSGNLTSIQAVNQQSYDSIMKQVNRPINYATGVISKPINR
MQEQTSMFFAEKYQGLMMSRLENKALSSSANKAVQNEVKRKYGIDHKDVNMQAGADYKNG
ISKLLDNKTFLPKGGDLDVKKLATMNFGQLRDEFAKNKYGAKNYSSLTSDQKLELDKFMK
SDLGEKGKSAKSLRELASDANFTRDYQSAYKYAHKEMSGRGVGLFGKNIGVLRSWQEMEN
RMKTKRELKEQKRVAIGEKIYAGYTGLKRDALTAIVGKDLRDKYEGNLTSAEWHDFDYND
PQLRTYSESLKDKERAREVKELQMQINKETLAVQEDILSPEYLARLKRPSDVEYYQELGQ
RRLIHEVRDRLSEGSDPVIMGDRFMQEKATDDQMRTMIDNAHQKHAEFIDQDRYTRRQEH
YDIMHEKAQENIDRTYKEIKDHFKRDDIKLEEMPALIAQYEREKPIESFDSKTELSLDKR
IEEAVSNFNINAKNYEYSASVLNNIEERKQAITDEVNTQIDRINKYRENAKMPQYQKPVE
NSGRKLRKLEDHLRNMK
NT seq 3474 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaatatttttattacattattaatatcgttattggcactgtcggggtgcagc
ggggatacttgtatcgatccggatgatttcggttttataaaatttaatatttcttctaga
tatgatccatctgaagttacttcaagacaagagggggatcaggtagcaccatggcgggat
agtgcttataaagtaaatggttatcctttaacaattatggtaagaccttgggattatatg
tctggggacaagaatacttcagggatgttatcagcatggtgtccatggtatgggcagcag
aataattttactaccttagctgagttttgtgttagactgcgaccatgtcaatttactgac
ggtaagatgtgtccaactcctacgccaagagatgcacctattaataatgctccttgtata
cttacaaacggggtagggctttattttttaattgctgataaaggttctaatcctaatatg
tcgccagattcacagcgtagtccgaaaggtataacgcagcatttaggtgaaccagttgca
agccaagattatgaattttatagtattagtagtactggaaagtttttacaagccggtggt
ataaattaccaatatggttgtactagcctaccttgcgatcaagcttcaaattatgctcaa
tcttctctatattttaaaattttagacaaattttatgatgataatagtggacaatatagg
gtagtaataaaatccggagtcagcgatacaagacctgatcccctacaatttttaacaaat
ttaataaagaatgagttatttggtactagcgataaagatcctggaattgtaaggcaaact
tatcagcaaataattgaaacacctggctataggttaagtgtttcggctcttttaactctt
tatataatgtttactggattttcctttttaataggaaacataaacatgactcatgttgag
ttagtagttagaatactaaaagtcagtgtagtttcaatattattaagtacaagtaaagct
tggacatttttccatgattatttatttgtattttttgttgaagggctagcacagatatta
caaatagtacaagatgcttcaacagggcaaagtttactaagccttcttatttccccgcaa
actttatctaagctattttctttattgtttgtagatccgcttgggtttatttatatcata
ctatatttaatagctctgtattttattttcttacttatattcaaagctacaattatttat
cttactgcattaataaccattggtatgattataacaatggcaccgatatttatttgtttc
atgttatttaatataactagatcgttatttgaaaattggttaaggcaattaatatcatat
gctatacaacctataattttatttgtcggtattgcttttatcggaatgattattaaaaca
gaaatacaatcgacattaggttttgccgtctgtaagaaagatttccccgatttaggacct
ataaatcaaatttttggtagttttacagaagatttagattcaagtattggtaattcgata
ttttattggtggtttccggtaccgatgaaaggaggaattgagaatttcactcaagcagat
atattagtccccgaagattataccaaaaaggatggtactaagtgtttggcatatcaatgt
atagataaacgttatattcaattaccgtttttagacttagttaaagatgcaaatagaatt
agtaattttataaatggtaaattcgtccagcttgatggcttattattgatatttgtttct
atttatttgcttagtaaatttaatgatactgctatatcgacggctagttttattgcgggt
acttctggtaatttaacatcgatacaggctgttaaccagcaatcttacgattctatcatg
aagcaggtcaatagaccgataaattatgcaacaggagttattagtaagccgataaaccga
atgcaagagcaaacgagtatgttttttgctgaaaaatatcaagggcttatgatgagtagg
cttgaaaataaagccctcagttcttcggctaacaaagcagtgcaaaatgaagttaaaaga
aaatatggtatagaccataaagacgttaatatgcaagccggagcagattataaaaacggc
atttctaaattgctagataataaaacgtttttaccgaaaggtggtgatttagatgtgaaa
aaactagcaactatgaattttgggcagcttcgagatgaatttgccaaaaataaatatggt
gcaaaaaattatagctctttaactagtgatcagaaactagagcttgataaattcatgaaa
tccgatttaggtgagaaaggtaaatcagcaaaaagcttacgtgagcttgcaagtgatgca
aactttactagagattatcaaagtgcttataaatatgctcataaagaaatgtcaggaaga
ggagttggtctatttggtaaaaatataggagtgcttagaagctggcaagaaatggaaaat
cgcatgaaaactaaacgtgaattaaaagaacaaaaacgtgtagctataggtgagaaaata
tatgccggctatacaggattaaaaagagatgctcttactgcgatagttggtaaagattta
cgtgataaatatgagggtaatctaactagtgccgagtggcatgactttgactataacgat
ccacagcttagaacttatagcgaaagtctaaaagataaagaaagagcacgagaagtcaaa
gagcttcaaatgcagattaataaagaaacgcttgctgttcaagaagatatattatcgcct
gaatatttagcaagattaaaaagaccaagtgatgtagaatattatcaggaattaggtcaa
agaaggcttattcatgaagtgcgtgatagattatctgaaggaagtgatccagtgataatg
ggtgatagatttatgcaagaaaaagctaccgatgatcaaatgcggactatgatagataat
gctcatcaaaaacatgcagaatttatagatcaagatagatatactcgtcgtcaagagcat
tacgatattatgcatgaaaaagctcaagaaaatatcgacagaacttataaagagattaaa
gatcatttcaaaagagatgatattaagcttgaggaaatgccagctttaatagcacaatat
gaaagagagaaaccaatagaatcttttgatagtaagacagagctttctctagataaaagg
attgaagaagcagttagtaactttaatatcaatgctaaaaattatgaatatagtgcatcg
gtgcttaataatatagaagaaagaaagcaggctattactgatgaagtaaatactcaaatt
gatcgaattaataaatatagagaaaatgctaaaatgccgcaataccagaaaccggtagaa
aattcaggaagaaagctcagaaaattagaagaccatttgagaaatatgaagtaa

DBGET integrated database retrieval system