KEGG   Rickettsia bellii OSU 85-389: A1I_00995Help
Entry
A1I_00995         CDS       T00602                                 

Gene name
tgt
Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Enzymes [BR:rbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     A1I_00995 (tgt)
Transfer RNA biogenesis [BR:rbo03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    A1I_00995 (tgt)
 Prokaryotic Type
    A1I_00995 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: ABV78597
UniProt: A8GUA5
Position
complement(191641..192726)
Genome map
AA seq 361 aa AA seqDB search
MSKFSFNINHQYKKARSGIITTAHGNIRTPAFMPVGTRGTVKAMLPESVAETGADILLGN
TYHLMLQPSAERIAKLGGLHKFMNWGKPILTDSGGFQVMSLSKLRKITEEGVSFNSHING
DKYLLTPERSTEIQHLLGSTITMAFDECTPYPATFEEAKTSMQLTTRWAHRSREAFVKRD
GYAQFGIIQGSTYEELREQSAKDLIELDFEGYAIGGLAVGEGQELMFKVLDYAPDFLPQN
KPRYLMGVGKPADIIGAVSRGVDMFDCVIPTRSGRNGQAFTKYGTVNIRNSKYAEDNDPL
EADCLCPACQNYSKAYLHHLVRIGEILGAMLMTWHNLTYFQNLMSRIREYIALGKDFDFT
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaattttcctttaatatcaatcatcaatataaaaaagcaagaagcgggattatt
actactgctcacggcaatattcgtacgcctgcttttatgccggtcggaacaagaggaact
gttaaagcaatgctgcctgaatcggtagccgaaacaggggctgatattctgcttggtaac
acctaccacttaatgctacaaccaagtgccgagcgtattgctaagcttggtggtttgcat
aaatttatgaattggggtaagccaatactaaccgattctggtggttttcaagtaatgtct
ttatcaaaattacgcaagataacggaagagggggtaagttttaactcgcatattaatggt
gataaatatttgctgacgcctgaacgttctaccgaaatacaacatctactcggcagcact
attaccatggcttttgacgaatgtacgccttaccctgcaacgtttgaagaagcaaaaacc
tctatgcagctcacaactagatgggcacatagatcaagagaagcgtttgttaagcgagat
ggttatgcacagtttggtattattcaaggtagcacttacgaagagttacgtgagcaatcg
gctaaagatttaatagagctagattttgaaggatatgctataggcggtcttgcagttggg
gaggggcaagaacttatgtttaaagttcttgattatgcccctgatttcctaccgcaaaat
aaacctagatatttgatgggggtaggaaagcctgctgatattatcggagcagtcagcaga
ggggtagatatgtttgactgcgtaatcccgactcggtcaggtcgtaatggtcaggctttt
acaaaatacggcacggtaaatatccgcaatagtaaatatgctgaagataacgatcctttg
gaagctgattgcctttgccctgcttgtcaaaattatagcaaagcctatttacatcacttg
gtgagaataggcgaaatacttggagcgatgctaatgacttggcacaatcttacatatttc
caaaaccttatgagccgtattagagagtatattgccttaggtaaagattttgattttact
acttga

DBGET integrated database retrieval system