KEGG   Rickettsia bellii OSU 85-389: A1I_01030Help
Entry
A1I_01030         CDS       T00602                                 

Gene name
ppnK
Definition
(GenBank) inorganic polyphosphate/ATP-NAD kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00760  Nicotinate and nicotinamide metabolism
rbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A1I_01030 (ppnK)
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     A1I_01030 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABV78604
UniProt: A8GUT7
Position
202044..202811
Genome map
AA seq 255 aa AA seqDB search
MNMNKIALVYNENSKSSSSIEEIKKLYTYCDVEDADVIMVAGGDGELLHNIHRYMHLNIP
FYGVNLGSLGFLMNPLDIKNILQNIQESTASTLNPLLMQAEDVDGQIHKALAINEVSIFR
KTNQAAKFRIEVNGVERMSELVADGALVATPAGSSAYNLSAGGHILPLESNMLCLTPICS
FRPRRWHGALLPSSASIKFEILNTNKRPVNATADFQEFSNIKSVTIKSTNDKSIKLLFNK
NHTLEDRIIKEQFGG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaataaaatagcattagtttataacgaaaattctaaatcttcaagtagtata
gaggaaataaaaaaactttatacttattgtgacgtggaagatgcggacgtaatcatggta
gctggcggggatggggagttattgcataacatacatcgttatatgcatttaaacatacct
ttttatggtgttaatttaggcagtctcggctttctgatgaatcctttggatattaaaaat
atactacaaaatattcaagaaagcaccgcatctactcttaatcctcttttaatgcaggct
gaagacgtagatggtcaaatacataaagctcttgcgattaatgaagtatcaatattccgt
aaaactaatcaagcagctaaatttagaattgaagtaaacggcgtagagcgaatgagcgag
ctagtagcagatggagctttagttgcaacaccagcaggtagcagtgcctataatttatct
gccggtggtcatattctccctctagagtcgaatatgctatgcctaacccctatatgctca
ttcagaccacgtagatggcatggggcattattgccgtcttcagcttccattaaatttgaa
atacttaatacaaataaaagaccagtaaatgccactgccgattttcaggaatttagtaat
ataaaatcagttactattaaatcgactaacgataagtctatcaaattgctctttaataag
aatcatactttagaagatcgtattattaaagaacagttcggcgggtaa

DBGET integrated database retrieval system