KEGG   Rickettsia bellii OSU 85-389: A1I_01060Help
Entry
A1I_01060         CDS       T00602                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1I_01060 (recR)
DNA repair and recombination proteins [BR:rbo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     A1I_01060 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A1I_01060 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HIGH_NTase1_ass
Motif
Other DBs
NCBI-ProteinID: ABV78608
UniProt: A8GUU1
Position
complement(206687..207289)
Genome map
AA seq 200 aa AA seqDB search
MNDNNNEIDQLIYLFSKLPGLGSRSARRIVLYLLQDKDVRLKTLINNLTEIDKKIVKCQV
CGNMDTENICGICTSEYRDKSVIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQNP
SILRLPELLDRCFKENIKEVIIATNSTLEGQTTAYFITEYLKDHPAKISRLASGIPIGGE
LDYLDEGTLSAAINLRQPFE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataataataacgagatagaccagctaatttatctattttctaagcttcctgga
cttggtagcagatcagcaagacgtatagtattatatttactgcaagacaaggatgtaagg
ctaaaaactcttatcaataatcttacagaaatagataagaaaatagtaaaatgtcaggtc
tgtggtaatatggatactgaaaatatttgcggtatctgcacatctgaatatcgagataaa
tcagttattgcaatcgttgaaactgttgctgaattatgggcgatggagcgtagtggtaat
ttcaaaggattatatcacgtgcttggtcataatttatcagcagctagcagacagaaccct
agtatcttaaggttaccagaactacttgatagatgctttaaggaaaatattaaagaagtc
attatcgcaactaactctactttagaaggacaaactactgcctattttattacggaatat
ctaaaagaccatcccgcaaaaatctctcgccttgctagcggcatacctatcggcggtgaa
cttgattatctagacgagggaactttatctgctgctatcaacctaaggcaaccttttgag
taa

DBGET integrated database retrieval system