KEGG   Rickettsia bellii OSU 85-389: A1I_01090Help
Entry
A1I_01090         CDS       T00602                                 

Definition
(GenBank) hypothetical protein
  KO
K12262  cytochrome b561
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    A1I_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB Cytochrom_B561 TMEM214
Motif
Other DBs
NCBI-ProteinID: ABV78614
Position
212058..212261
Genome map
AA seq 67 aa AA seqDB search
MLLTNTENSYGLIAKLFHWVMSIMVILMLIAGFLMDDYIEPPLKWQIFGLHEATGVLVLT
LVTLRLL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgctacttacaaatactgaaaattcttatgggttgattgctaaacttttccactgggtt
atgagtattatggttatattaatgctcattgctggttttttaatggatgattacatagag
ccgcctttaaaatggcaaatatttggcttacatgaagcaaccggagtgctagttttaact
ttagttacattaaggcttttatga

DBGET integrated database retrieval system