KEGG   Rickettsia bellii OSU 85-389: A1I_01200Help
Entry
A1I_01200         CDS       T00602                                 

Definition
(GenBank) Transposase and inactivated derivative
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABV78636
Position
230909..231670
Genome map
AA seq 253 aa AA seqDB search
MYSLCERGYVVHRADARKVKNFIRSYGNSAKTDKLDAKALGLYGKERADKLEVFKPESKQ
NIQLFRLVQRRNDLKQMLVAEKNRLQQANTDKFVKNSCINMIDVLSNQITEITNQVEVII
SSDQLLKAKHEILKEINGIGNIVAFELLILLPELGKLTRRQIASLAGLAPKANDSGKYQG
YRKVGHGRAGVKPILFLAAMSARNSKTSGLRLFYERLINNGKKKMVALTALMRKIIVIAN
AKLKSLLFNLKHS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtatagcttatgtgaaagaggttatgtagtacatagagcagatgcaagaaaggtaaag
aattttatcagatcatatggtaatagtgcaaaaacagataagttagatgctaaagcatta
ggattatatggtaaggagcgagcagataagcttgaagtatttaagcctgaatcaaaacaa
aatatacaattatttcggttagtacaaagacggaatgatttaaagcaaatgttagttgcc
gaaaagaatagattacaacaagcaaatacagataagtttgttaaaaatagctgtataaat
atgatagatgttttaagtaatcaaattacagagattactaatcaggtagaagtaattata
tcatcagatcagctgttaaaagcaaagcatgagatattgaaagagataaatggcattggt
aatatagttgcttttgagttattaatattattaccggagttagggaagttaacaagacgg
cagattgcttctcttgcagggcttgctccaaaagctaatgatagtggtaaatatcaagga
tatagaaaggtaggacatggtagagcaggagtcaagcctatactattccttgctgctatg
tcagcccgtaatagcaagacttctggtttaagactcttttatgagcgactcattaacaat
ggtaaaaagaaaatggtcgctcttaccgctttaatgcgtaaaattattgtcatcgctaat
gctaaattaaaatctcttctttttaatttaaaacatagttga

DBGET integrated database retrieval system