KEGG   Rickettsia bellii OSU 85-389: A1I_01220Help
Entry
A1I_01220         CDS       T00602                                 

Definition
(GenBank) Ferredoxin
  KO
K05524  ferredoxin
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    A1I_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3470 Fer4 Fer4_21 Fer4_10 Fer4_16 Fer4_9 Fer4_7 Fer4_2 Fer4_8 Fer4_4 Fer4_6 Fer4_17 Fer4_20
Motif
Other DBs
NCBI-ProteinID: ABV78640
Position
complement(235996..236319)
Genome map
AA seq 107 aa AA seqDB search
MTYVVTDECVKCKYTDCVEVCPVDCFYEGEFMLVINPDECIDCGVCVPDCPIDAIKPETP
ELIEWVERAKHFIEHEKWQVITKKKPALPDADKFKDEKDKFNKYIGV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgttgtaactgatgaatgcgtgaaatgtaaatatactgattgtgttgaagta
tgtccggtagattgtttttatgagggtgagtttatgctggttatcaatccggatgaatgt
atagattgcggggtatgcgtgcctgactgcccaatagatgcaataaaacctgaaacacca
gaattaattgaatgggtagagcgagcaaaacactttatagaacatgaaaaatggcaagtt
attactaagaaaaaacccgccctaccagatgctgataaattcaaagatgaaaaagataaa
tttaataaatatattggtgtataa

DBGET integrated database retrieval system