KEGG   Rickettsia bellii OSU 85-389: A1I_01235Help
Entry
A1I_01235         CDS       T00602                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00230  Purine metabolism
rbo00240  Pyrimidine metabolism
rbo01100  Metabolic pathways
rbo03030  DNA replication
rbo03410  Base excision repair
rbo03420  Nucleotide excision repair
rbo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1I_01235
   00240 Pyrimidine metabolism
    A1I_01235
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A1I_01235
   03410 Base excision repair
    A1I_01235
   03420 Nucleotide excision repair
    A1I_01235
   03440 Homologous recombination
    A1I_01235
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A1I_01235
DNA replication proteins [BR:rbo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     A1I_01235
DNA repair and recombination proteins [BR:rbo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     A1I_01235
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     A1I_01235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_2 HHH_5
Motif
Other DBs
NCBI-ProteinID: ABV78643
Position
238601..241216
Genome map
AA seq 871 aa AA seqDB search
MTKKNTLLLIDGYGFVFRAYYAQQPLTSPKGEPVGALYGFTSMLLKLLNDFKPKHAAVVF
DSGGKNFRHEIYPEYKANRPPPPEDLIAQLPLVRDVARNLNFPILEKNGFEADDIIATFA
AKTASIGEEVVVISSDKDLLQLMNDNVKIYDPLKAKYITEDNVVEKFGVTSDKLREVMAL
IGDKSDNIPGVPSIGPKTASSLITQFGTVENIFNSLEQVSSIKQRETLQNSKEAALISWQ
LIGLDYNVDMDFKLDALEWSPPDHNKLTEFLHEYGFKSLYKRAENLFDIKISEHKEVIEE
KAVEIKDISNKAELEAFAEKAKKVGIFGIYILQNKGANIAFILSLKNQAYIIKISNEANN
LFTYNSKADNEWFTDIIFNLLTDQSIKKITYSLKPLLKFYASRAQQITAIEDLELMNYAL
SAGLPQKNLFEAVEKEATIEEAAKIVVGFIDLYQQTILELKDNKAFRIYKEIDLPVCFVI
DKMEKAGIKVDANYLNQLSSEFGAEILKLEEEIFVLSGMKFNIGSPKQLGEILFEKMQLP
FGKTSAKANSYSTGADILEKLSEQGYPIADLLLRWRQLTKLKNTYTDSLPKQIDNITRRI
HTTFLQTSTTTGRLSSQEPNLQNVPIRSGEGNKIRQAFVAEQGYKLISADYSQIELRILS
HIADIKALKQAFINKDDIHTQTACQIFNLQKEELTSEHRRKAKAINFGIIYGISAFGLAK
QLNVSNTEAAEYIKKYFAEYKGVQEYMEATKSFAQANGYVTDFFGRKCFVPLINDKRLKQ
FAERAAINAPIQGTNADIIKIAMTLLDREIEKRKLKTRLVLQIHDELLFEAPIDEIETIM
PIIKQIMENSTNMDVPIITEIRAGNNWMEIH
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaaaatactttactgcttatagacggatacggatttgttttcagagcctat
tatgcacaacagcctttaacttccccaaaaggtgagcctgtaggggctctttacggcttt
acgtcaatgttgctaaagctacttaatgactttaagccgaagcatgcagcagtagtgttt
gacagtggtgggaaaaatttccgtcatgaaatttatcctgaatataaagctaatcgtcca
ccaccgcctgaggatttgattgcacaattgccattagtacgtgatgttgcaagaaattta
aacttcccaattttagaaaaaaatggctttgaagctgatgatatcatagcaacttttgct
gctaaaactgcttctattggggaagaagtagtggtcatatcttctgataaagatctattg
caattaatgaatgacaatgtaaaaatatatgacccgctaaaagccaaatatattacagaa
gataatgttgttgaaaaattcggcgttacttctgataaattacgtgaggtgatggcttta
atcggtgataaatctgataatatccctggtgtgccgtcaataggaccaaaaaccgcaagc
agccttattacccagtttggtacagttgagaatatctttaattccctagagcaagtttca
agcataaaacaacgtgagacgctacaaaactcaaaagaagctgctctaatctcatggcag
ttaattggactagattataatgttgacatggatttcaagctagatgctctggaatggtcg
ccacctgatcataataaattaacagagtttctacatgaatatggctttaaatctttatat
aaaagagcagagaatttatttgacattaaaattagtgaacataaagaagtaatagaagaa
aaagccgtagagataaaagatatcagtaataaagctgagcttgaagctttcgctgaaaag
gctaaaaaagtagggatatttggaatatatatattgcagaataaaggagctaatattgca
tttattttatccctaaaaaatcaagcttatattattaaaatctcaaatgaggctaataat
ctttttacttataattctaaggctgataatgaatggtttacagatattatttttaattta
ctaactgaccagtcaataaagaaaatcacttattcactaaaacctctgctgaaattttat
gctagtagggcacagcaaattacagcaatcgaagatttagagttaatgaattatgcacta
tccgcaggtctgccgcaaaaaaatctatttgaagctgtagaaaaagaagcaacaatagaa
gaggcagcaaaaatagtagtaggctttatcgatctttatcagcaaactattttagagctt
aaagataacaaggcttttagaatttataaagaaatcgatttacctgtttgctttgtaata
gataaaatggaaaaagctggcataaaggtagatgcgaattatttaaatcagttatctagc
gaatttggagcagaaatattaaagcttgaggaagaaatttttgttttaagtggcatgaag
ttcaatattggttcaccaaaacaattaggtgaaattttatttgaaaagatgcaattacca
ttcggtaaaacttcagctaaagcaaattcctattcaacaggggctgatatactcgaaaag
cttagcgagcagggttatcctattgcggatttattgctaagatggcgtcaacttaccaag
ctaaaaaatacttatactgatagtctgccaaagcaaatagataatataactcgtcggatt
cataccacttttttgcaaacttccactactacaggacggcttagctcacaagagcctaat
ttgcaaaatgtacctattagatcaggggaggggaataaaatcaggcaagcttttgttgca
gagcaaggctataaattaatatcagcggattactcgcaaatagagcttagaatattaagc
catattgcggatataaaggctttaaaacaagcatttattaataaagatgatatccatacc
caaactgcttgccagatcttcaatttacaaaaagaggagttaactagcgaacatagacgt
aaagcaaaagctataaattttggtattatttacggaataagtgctttcgggcttgcaaag
cagctaaatgttagtaataccgaagctgccgaatatatcaaaaaatattttgctgaatat
aagggcgtgcaggaatatatggaagcgactaaaagctttgctcaagcaaatggatatgtt
actgatttcttcggacgtaaatgttttgtgccgctaattaatgataaaagactcaagcaa
tttgccgagcgtgccgctattaatgccccgattcaagggactaatgccgatataatcaaa
atagcgatgaccctacttgatagagaaatagagaagcgtaaactcaaaactaggttagtg
ttgcaaattcacgatgagttactatttgaagcaccaatagatgaaatagaaacgataatg
cctattatcaaacaaattatggaaaattctaccaatatggatgtaccaattattaccgaa
attagagctggtaataattggatggaaatacattag

DBGET integrated database retrieval system