KEGG   Rickettsia bellii OSU 85-389: A1I_01320Help
Entry
A1I_01320         CDS       T00602                                 

Definition
(GenBank) Antitoxin of toxin-antitoxin (TA) system StbD
Organism
rbo  Rickettsia bellii OSU 85-389
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhdYeFM_antitox
Motif
Other DBs
NCBI-ProteinID: ABV78656
Position
259743..259970
Genome map
AA seq 75 aa AA seqDB search
MNISATELNKNPGKIIDQALREPIVINKQGRPTVVLVDYEYFTKLEDDYWGKAAKNIAEQ
PEWLSAKESEKFLRS
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatctgcaactgaattaaataagaatcctggaaaaattattgatcaagcatta
agagagccaatagtcattaacaaacaaggtagacctactgttgttttagtagattatgaa
tattttactaaacttgaagatgattattggggaaaggcagcaaaaaatattgcagaacaa
ccggagtggctatcagcaaaagaatcagaaaaatttcttagaagctaa

DBGET integrated database retrieval system