KEGG   Rickettsia bellii OSU 85-389: A1I_01325Help
Entry
A1I_01325         CDS       T00602                                 

Definition
(GenBank) Cytotoxic translational repressor of toxin-antitoxin (TA) system RelE
  KO
K06218  mRNA interferase RelE/StbE
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Prokaryotic defense system [BR:rbo02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   RelE/StbE-RelB/StbD
    A1I_01325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParE_toxin ParE-like_toxin
Motif
Other DBs
NCBI-ProteinID: ABV78657
Position
259974..260246
Genome map
AA seq 90 aa AA seqDB search
MREIVLEKRVIKTLERYPEKHQRQVKNKILSLMENPIPNNSKLLVGYPHFHRCDIEEYRI
IYNFNESTIYVILVGKRNDSEVYKLLKNIF
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatagttttagaaaaaagagtaataaaaacgttagaacgttaccctgaaaag
catcagcgtcaagttaaaaataaaattctgtctttaatggaaaatccaataccaaataat
agtaaattattagtaggttatcctcatttccatagatgcgatatcgaagaatatagaata
atttacaactttaatgaaagtacgatttacgttatattagttggcaaacgtaatgactct
gaagtgtataagttattaaaaaatattttctga

DBGET integrated database retrieval system