KEGG   Rickettsia bellii OSU 85-389: A1I_01365Help
Entry
A1I_01365         CDS       T00602                                 

Definition
(GenBank) NADH dehydrogenase I chain F
  KO
K00335  NADH-quinone oxidoreductase subunit F [EC:1.6.5.3]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00190  Oxidative phosphorylation
rbo01100  Metabolic pathways
Module
rbo_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    A1I_01365
Enzymes [BR:rbo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     A1I_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-ProteinID: ABV78665
UniProt: A8GYE0
Position
266321..267574
Genome map
AA seq 417 aa AA seqDB search
MLKKEDRIFTNLHGEQSHDLKSSKKLGDWDNTKALLNKGKEWIIEEVKKSGLRGRGGAGF
STGTKWSFMPKESKKPSYLVVNADESEPGTCKDRDILRYEPHKLIEGCLLASFAIGANSC
YIYIRGEFYNEASNIQRALDEAYKDGLIGKNACGSGFNCDIYLHRGAGAYICGEETALLE
SLEGKKGMPRLKPPFPAGFGLYGCPTTINNVESIAVVPTILRRGASWFASIGKPNNTGTK
IFCISGHVNKPCNVEEAMGIPLKEIIEKHAGGVRGGWDNLKAIIPGGSSVPLLPKSLCET
ADMDFDSLKAAGSSLGTGGIIVMDKSTDIIYAIARLSKFYMHESCGQCTPCREGTGWMWR
VMMRLVKGDAKKSEIDQLLEVTKEIEGHTICALGDAAAWPIQGLIKHFRNEIESRIQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaagaagatagaatttttactaatttacatggtgagcagagccatgatttg
aaatctagcaagaagcttggtgattgggataatactaaagcattacttaataaaggcaaa
gagtggattattgaagaagttaagaaatcgggacttagagggcgaggtggtgcaggattt
tctaccggcactaaatggtcgtttatgcctaaagaatcaaaaaagccatcttatctagta
gttaatgctgatgaatctgaacccggcacttgcaaagatcgggatatattaagatatgaa
ccacataagttaatagaagggtgtttgcttgccagttttgccataggagcaaatagctgt
tatatctatattagaggggagttttacaacgaagcttccaatattcagcgtgccttagat
gaagcatataaagatggtttgataggaaaaaatgcttgcggttcaggctttaattgtgat
atttatttgcatcgtggagctggagcttatatttgtggagaagaaacagctctgcttgaa
agcttagaaggtaaaaaaggcatgccaaggctaaagccgccttttccggcgggcttcggg
ttgtatggctgtccaaccactataaataatgttgaatctattgcggtagtgccaactatt
ttaaggcgaggagctagttggtttgcatctatcggtaagccaaataataccggtactaag
attttttgtatatcaggtcatgttaataagccttgtaatgttgaagaggcaatggggatt
cctttaaaagaaatcattgaaaaacatgcagggggtgttcgtggcggttgggataacctc
aaagctataataccgggtggctcttccgttcctttgcttcctaaatccttatgcgaaact
gccgatatggactttgatagcttaaaggcagcaggctctagtttaggtactggcgggatt
attgttatggataaatcgactgatattatttatgcaatagcacgtcttagtaagttctat
atgcatgagtcttgcggtcagtgtacgccgtgccgtgagggtacaggatggatgtggcgt
gttatgatgaggctcgttaaaggtgatgccaaaaaatccgaaatagatcagcttcttgaa
gttacaaaggaaatagaggggcataccatttgtgctttaggtgatgctgccgcttggcca
attcaggggctgataaaacattttagaaacgagattgaaagcaggatacaatag

DBGET integrated database retrieval system