KEGG   Rickettsia bellii OSU 85-389: A1I_01445Help
Entry
A1I_01445         CDS       T00602                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00020  Citrate cycle (TCA cycle)
rbo00190  Oxidative phosphorylation
rbo00650  Butanoate metabolism
rbo01100  Metabolic pathways
rbo01110  Biosynthesis of secondary metabolites
rbo01120  Microbial metabolism in diverse environments
rbo01130  Biosynthesis of antibiotics
rbo01200  Carbon metabolism
Module
rbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1I_01445
   00650 Butanoate metabolism
    A1I_01445
  Energy metabolism
   00190 Oxidative phosphorylation
    A1I_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABV78681
Position
280599..280976
Genome map
AA seq 125 aa AA seqDB search
MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE
LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIVAFIVA
VFYRG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacatatgattttagagcagagattgtaaaagcaaaaaatactggttctgctaaaagt
ggttcacatcattggttgctacaaagaattaccgctattatattagtgttgtgttcttta
tggttactatattttacgctagccaataaaaatagtgatgtaaatattattatttgggag
ctgaaaagacctattaatttaatacctttattaatcgcagtaattacttctttatatcat
gccatgcttggaatgcaggtagtaatagaggattatataagctgcaacaagttacgtaat
acattaattatagcagtgaagctatttagtattctaactatcgtagcttttatagtagct
gtgttttataggggataa

DBGET integrated database retrieval system