KEGG   Rickettsia bellii OSU 85-389: A1I_01480Help
Entry
A1I_01480         CDS       T00602                                 

Definition
(GenBank) elongation factor G
  KO
K02355  elongation factor G
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
Translation factors [BR:rbo03012]
 Eukaryotic Type
  Elongation factors
   A1I_01480
 Prokaryotic Type
   A1I_01480
Mitochondrial biogenesis [BR:rbo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A1I_01480
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    A1I_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_II EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1 GTP_EFTU_D4 AIG1
Motif
Other DBs
NCBI-ProteinID: ABV78688
UniProt: A8GV17
Position
285465..287558
Genome map
AA seq 697 aa AA seqDB search
MSKKLENIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHEGGATMDWMEQEQERGIT
ITSAATTCRWQDKQINIIDTPGHVDFTIEVERSLRVLDGAVAVFDGVAGVEPQSETVWRQ
ADKYNVPRMCFVNKMDRMGADFYRCVDMIKDRLGAKPLVIQLPIGIEENFKGVVDLVKMQ
AVVWKDESLGAEYSYQEIPDDMKAKAEEYRANLLDMVVELDDKIMEKYLSGEEVTEEEIK
KLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDYLPSPIDIATVKGVEVSTGEEKDFP
ISVSEPFSALAFKIMNDPFVGSLTFIRVYSGKITSGTTVINTVKNKREKIGRMLLMHANN
REDVKEASAGDIVALAGLKDTTTGDTLSDEDKKVILERMEFPEPVIELAVEPKSKVDQEK
MGLALSRLAAEDPSFRTSTDQETGQTVIKGMGELHLEIIIDRMRREFKVEANIGAPQVAY
RETITKACEIDYTHKKQSGGAGQFARVKIIFEPLKDVKDLKEEDKNKSFIFESKIVGGAV
PKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLIDGAFHDVDSSVLAFEIAAKAAFREGM
PKGNPKLLEPIMKVEVITPDEYMGDVIGDLNSRRGQVQGMEPRGNAQVIKAYVPLAEMFG
YVNTLRSLSQGRAQYSMVFNHYDQVPTQVADTIKAKK
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagcttgaaaatatccgtaatatcggtatatgtgctcatattgatgcaggt
aaaactactactacagaacgtattctatattatacaggtaaatcccataaaataggtgaa
gttcatgagggcggtgctaccatggactggatggagcaggagcaagaacgtggtataaca
attacctcggctgctactacttgtagatggcaagataaacaaattaatattattgatact
cctggacacgttgactttacaattgaagtagagcgttctttacgtgttcttgatggtgct
gttgcagtgtttgatggcgttgcaggtgttgaacctcaatctgaaacagtatggagacaa
gctgataaatataatgttcctagaatgtgttttgtcaataaaatggacagaatgggagca
gacttttatagatgcgttgacatgatcaaggatcgtttaggagcaaagcctttagttatt
cagcttccaataggtattgaagaaaatttcaaaggggttgttgatcttgttaaaatgcaa
gcagtagtttggaaagatgagtctttaggtgctgagtattcttatcaagaaattcctgat
gacatgaaagcaaaagcagaagaatatcgtgctaatttgcttgatatggttgttgagcta
gacgataaaatcatggaaaaatacttgtctggtgaggaagtaactgaagaagagattaag
aagttaataagaaaaggtactatttcagcagctttttatccagttttatgtggtagtgca
tttaaaaataaaggcgtacagcctctacttgatgctgtagtagattatttaccatcacct
attgatattgctacagtaaaaggtgttgaagttagtacaggtgaagaaaaagacttccct
atttctgtttctgagccattttctgccttagcatttaaaattatgaatgatccgtttgtt
ggttcattaacttttattagagtgtattcaggtaagattacttccggaacaactgttatt
aatactgtaaagaataagagagagaaaataggtagaatgctattaatgcatgctaataac
cgtgaggatgtaaaagaagcatcagcaggtgatatagtagcattagcagggcttaaagat
actactactggtgatacattatcagatgaagataaaaaagtaattctcgaaagaatggaa
ttccctgagccagttattgagcttgcagtagagcctaagtcaaaggttgatcaagaaaaa
atgggactagctctttctcgtttagcagctgaagatccttcatttagaacttcaactgat
caagaaacagggcaaactgttattaaaggaatgggtgagcttcatttagagatcattatc
gatcgtatgagaagagagtttaaagttgaagcaaatattggagctcctcaagttgcatat
cgtgaaacaattactaaagcttgcgaaattgattatactcataaaaagcaatcaggcggt
gcaggtcaatttgcacgtgtaaaaattatttttgaacctctaaaagatgtaaaagatcta
aaagaagaagataaaaataagagcttcatttttgaaagtaaaattgttggcggtgctgta
cctaaagaatatattcctggcgtagaaaaaggattaaataacattagggaaacaggcgta
attgcaggttatcctatgatcgattttaaagctacattaattgatggtgctttccatgat
gtggattctagcgtacttgcgtttgaaattgcagcaaaagcagcatttagagagggaatg
cctaaaggtaatcctaaattgcttgagccgattatgaaagttgaggtgattacaccagat
gagtatatgggtgatgttattggtgatttaaatagtcgtagaggacaagttcaaggtatg
gagccaagaggtaatgctcaagtgatcaaggcatatgttcctttagctgaaatgttcggt
tatgttaatacgcttagatctttatcacaaggtagagctcagtatagcatggtatttaat
cattatgatcaagtaccaactcaagttgcagatactattaaagctaaaaaataa

DBGET integrated database retrieval system