KEGG   Rickettsia bellii OSU 85-389: A1I_01505Help
Entry
A1I_01505         CDS       T00602                                 

Gene name
rplJ
Definition
(GenBank) 50S ribosomal protein L10
  KO
K02864  large subunit ribosomal protein L10
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo03010  Ribosome
Module
rbo_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A1I_01505 (rplJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbo03011]
    A1I_01505 (rplJ)
Ribosome [BR:rbo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1I_01505 (rplJ)
  Bacteria
    A1I_01505 (rplJ)
  Archaea
    A1I_01505 (rplJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10 SRP54_N
Motif
Other DBs
NCBI-ProteinID: ABV78693
UniProt: A8GV22
Position
290094..290603
Genome map
AA seq 169 aa AA seqDB search
MLRSEKPEVVEEIASIYKDSPSVIVAHYHGLTVSEVNSLRESLKSKDAGFKVVKNTLAKI
AANKAGLDDIVSLFSGPTAIVYSKEPVEMAKLVVNFAKSNENLKIVGGIVDKQVLNEHSI
KELSKLPSLNELRSKIVGLLQAPATKIAGVLQAPSSSLARVIQANASKN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgttaagatcagaaaaaccggaagttgtagaagaaatagcaagtatttataaagattcg
ccatctgtaatcgttgctcattatcacggattaactgttagtgaagtcaattcacttaga
gagtctcttaagtctaaagatgcaggttttaaagttgttaaaaatactttagcaaaaata
gcagcaaataaagcaggtcttgatgatatcgtaagcttattttcaggtcctaccgctatt
gtttattctaaagaaccggttgaaatggcaaaattagtagttaattttgctaaaagtaat
gaaaatcttaagattgttggcggtatagtcgataaacaagtattaaatgaacattcaata
aaagaactttctaagttaccttcattaaatgagcttagaagtaaaattgttgggttatta
caagctccggctactaagattgcaggcgttttacaagcaccgtcttcaagcttagccagg
gtaatacaagcaaatgctagtaaaaattaa

DBGET integrated database retrieval system