KEGG   Rickettsia bellii OSU 85-389: A1I_01515Help
Entry
A1I_01515         CDS       T00602                                 

Gene name
rpoB
Definition
(GenBank) DNA-directed RNA polymerase subunit beta
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00230  Purine metabolism
rbo00240  Pyrimidine metabolism
rbo01100  Metabolic pathways
rbo03020  RNA polymerase
Module
rbo_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A1I_01515 (rpoB)
   00240 Pyrimidine metabolism
    A1I_01515 (rpoB)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    A1I_01515 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rbo03021]
    A1I_01515 (rpoB)
   03400 DNA repair and recombination proteins [BR:rbo03400]
    A1I_01515 (rpoB)
Enzymes [BR:rbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     A1I_01515 (rpoB)
Transcription machinery [BR:rbo03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     A1I_01515 (rpoB)
DNA repair and recombination proteins [BR:rbo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      A1I_01515 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_3 RNA_pol_Rpb2_1 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_45 DUF5121
Motif
Other DBs
NCBI-ProteinID: ABV78695
UniProt: A8GV24
Position
291638..295756
Genome map
AA seq 1372 aa AA seqDB search
MVSLRDNIEVQPLSHNKRVRKNFGHINLVADIPNLIEIQKNSYEKNFLQLDTKDSERKNK
GLQSILNSIFPISDPSNIANLEFVKYEFDTPKYDVEECTQRSLSYDSALKVTLRLSIWDI
DEDTGSREIKGIKEQQVYMGNIPLMTKNGTFIINGTERVVVSQMHRSPGVFFYHDEGKVH
SSRKLLYSARVIPYRGSWLDLEFDAKDIIYFRIDRKRKLYATTLLKAIGMSTEEIIKFYY
DSVNYKVVKNKGWAVKFMPSHITAHRLTSDLIDADTGNVLLKAGQKITPRLAKKYAGEGL
NNILVSHEALIGKYLSEDLKDPESDEILAKIGEMITVELLSVISDLKIKNISVLVINPQS
GPYIRNTLFSDKNQDRESALFDIFRVLRPGEPANIEAAESLFYNLFFDPERYDLSEVGRI
KMNSRLELNISDETTVLTTDDIKNILRVLVELKDRKGIIDDIDHLGNRRVRSVGELIENQ
FRIGLVRMEKSVVERMSAGDIDTVMPHDLVNSKILVSVVKEFFSTSQLSQFMDQTNPLSE
ITHKRRLSALGPGGLSRDRAGFEVRDVHPTHYGRICPIETPEGQNIGLINSMATYARINK
HGFIESPYRKVKDGHVTDEVVYLSAIEEGKYKIGQANSKVDKDGILQGEFINCRVEGGNF
VMVEPHEVDFIDVTPMQVVSVAASLIPFLENDDANRALMGSNMQRQAVPLIKTDAPFVGT
GVEGVVAKDSGASVLALNDGIVEQVDSNRIVIRAIGQKTESAPSVDIYNLLKFQKSNHNT
CINQKPLVKVGHYVKKNDIIADGPSTDNGEIALGRNVLVAFLPWNGYNFEDSILISERIV
KEDVFTSVHIEEFEVIARDTRLGPEEITRDIPNVSEEALRHLDEVGIIYVGAEVKAGDIL
VGKVTPKSESPITPEEKLLRAIFGEKAFDVKDSSLHVPSGVSGTVVEVRVFSRRGVEKDQ
RAIAIEKQQIEKLAKDRDDELEIIEHFVFSWLEKLLVGQVSINGPKTVKTGQTITSEILK
GLSKGQLWQFTVEDANVMNEIEQLKGHYDGKKEALNKRFATKVEKLQSGDDLPQGALKVV
KVFIATKHKLQPGDKMAGRHGNKGVISRIVPEEDMPFLEDGTVVDIVLNPLGLPSRMNIG
QVLETHLGWASVNLAKKIAGLVEEHKTKHASIEKIKKFLIELYGENINHILEKSDEEIIS
FCNEAAKGVYFATPVFDGAKVEDVKDMLRLAGQDLSGQVKLIDGRTGEYFDRLVTVGQKY
LLKLHHLVDNKIHSRSIGPYSLVTQQPLGGKSHFGGQRFGEMECWALQAYGAAYTLQEML
TVKSDDVNGRIKIYDSIVRGENNFESGIPESFNVMIKEFRSLCLNVKLEVTS
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattaagggataatattgaagtacaacccttgtcacataataaaagagtaaga
aaaaattttggtcatataaatttagtagcagatataccgaatttgattgaaattcaaaaa
aattcatatgaaaaaaattttctacagctagatacaaaagattccgaaagaaaaaataaa
ggcttacaatctatattaaattcaatttttcctatctctgatccttctaatatagctaat
ttagaattcgttaaatatgaatttgatactccaaaatatgatgtggaggaatgcactcaa
agaagcttaagctatgattctgctcttaaagtaaccttaagattaagtatctgggatata
gacgaagatactggaagccgagagattaaaggtatcaaagagcagcaagtatatatgggt
aatatcccattaatgactaaaaatggtacttttatcattaatggtacagaaagggtagtt
gtatcgcaaatgcatcgctcacctggggtattcttctatcatgatgagggcaaagttcat
tcttctagaaaacttttatattctgcacgtgttattccatatagaggatcatggcttgat
ttagagtttgatgctaaagatattatttattttagaatagatagaaaaagaaaactttat
gctactactttgcttaaagcaataggcatgagtacagaagaaattataaaattttattat
gattcagtaaattataaagttgttaaaaataagggatgggcagttaaatttatgcctagc
catattactgctcatagattaacaagtgatttaatagatgctgatacgggaaatgttttg
cttaaagcagggcaaaaaattactcctcgcttagctaaaaaatatgctggggaaggactt
aataatattttagtatctcatgaagctttgattggtaaatatttatctgaggatttaaaa
gaccctgaaagcgatgaaatattagcaaaaatcggtgaaatgattactgttgaattactt
agtgtaattagtgatcttaaaattaaaaatattagcgtattagtaattaatcctcaatct
ggtccatatataagaaatactttattttctgataaaaaccaagatcgtgaatcagcatta
tttgatatttttagagtattaagaccgggagagcctgctaatattgaagctgctgaaagt
ttattttataatttattctttgaccctgaaagatatgatctttcagaagtaggtcgaata
aaaatgaattcaaggttagaactaaatatctctgatgaaactactgttttaactacagat
gatataaaaaatatactaagagttttagtagagcttaaagatcgcaaagggattatagac
gatattgatcacttaggtaacagaagggttagatcggttggtgaattgatagaaaatcaa
ttcagaataggtcttgtccggatggaaaagtcagtagttgaaagaatgtcggcaggtgat
attgatacagtaatgcctcacgatttagtgaattccaaaattttagtttctgtagtaaag
gaattcttcagtacttcgcaattatcccaatttatggatcaaacaaatccattgtctgaa
ataactcataaaagaagattatcagcattagggcctggtggtcttagtcgtgatagagca
ggttttgaagtgcgtgatgtgcatccgactcattacggtcgtatctgtcctattgaaaca
cctgaaggtcaaaatatcggactaattaactctatggcaacttatgctagaataaataag
catggttttatagaaagcccatatagaaaagtcaaagatgggcatgtaaccgatgaagta
gtatatctttcagctattgaagaagggaagtataagatcggtcaagcaaattctaaggtt
gataaagatgggatattacagggcgaatttattaattgccgagttgaaggtggcaatttt
gtaatggtagagccacacgaagtagacttcattgatgtaacgcctatgcaggttgtatct
gttgcagcttctcttataccgttcttagaaaatgatgatgctaaccgtgctttgatggga
tcaaacatgcaaagacaagcggttcctttaattaaaactgatgcaccttttgtgggtaca
ggagttgagggagtagtagcaaaagattctggagcatctgtgcttgcattaaatgatggt
atagttgagcaagtagattcaaatagaattgtaattagagctattggtcaaaaaaccgaa
agtgcaccttcagttgatatttataacttattaaaattccaaaaatctaatcataatact
tgtatcaatcaaaaacctttagttaaggtaggtcattatgttaagaagaatgatattata
gctgacggacctagtaccgataatggtgaaattgctttaggcagaaatgttttagtcgct
ttcttgccttggaatggatacaattttgaagattcaattttaatatcagagcgaatagta
aaagaagacgtatttacttctgtccatattgaagagtttgaagtaatagcaagagatact
cgccttggtcctgaagagattactcgtgatataccgaacgtaagcgaggaagctctgcgt
catttagatgaagtcggaataatttatgtaggtgcagaagtaaaagcaggtgatatttta
gtagggaaagtaacgccgaaaagtgaatcacctattactcctgaggaaaaattactgaga
gctatttttggagaaaaagcttttgatgtgaaagattcatcgctgcatgttccttccggg
gttagcggaacggtagtagaagtaagagtattctctcgtcgaggtgttgaaaaagatcag
cgtgctattgctattgaaaaacaacaaattgagaaattagcaaaagaccgtgatgatgaa
ttagaaattattgagcattttgtatttagttggcttgagaagcttttagtaggacaggta
agtattaatggtcctaagacagtaaagactgggcaaactattacaagcgaaatattaaaa
ggtttatctaaaggacaactttggcagtttactgttgaagatgcaaatgtaatgaacgaa
atagagcagctaaaaggtcattatgatggcaaaaaagaagctcttaataagaggttcgct
actaaggtagaaaaattacaaagcggagacgatttacctcaaggtgctttaaaagtagta
aaagtatttatcgcaactaagcataaattacaacctggtgataaaatggcaggaagacac
ggaaataaaggtgttatttcacgtattgtgccagaagaggatatgccattcttagaagat
gggactgtagttgatattgttctcaatcctttaggtcttccttctcgtatgaatataggg
caagtgcttgaaactcatcttggttgggcatcagtgaatctagcaaaaaaaatagcaggt
ttagtagaagaacataaaactaaacatgcaagtattgagaagattaagaagtttttaatc
gagctatatggtgagaatattaatcatatacttgaaaaatctgacgaagaaattatttca
ttctgtaatgaagctgctaagggagtatattttgcaactccagtatttgatggtgcaaag
gttgaagacgttaaggatatgctaaggcttgcaggtcaagatctttcagggcaagtaaag
ctaattgatggtagaacaggtgaatattttgatcgcttagtaactgtagggcagaaatat
ttattaaagctacatcacttggtagataataaaattcactctcgttctataggtccttat
agtttagtgactcaacaacctcttggaggaaaatcgcattttggtggtcagcgtttcggg
gaaatggaatgctgggcattacaagcatatggagctgcttatacgttacaagaaatgtta
actgttaaatcagatgacgtaaatggtagaattaagatttatgactctatagtgcgtggt
gaaaataattttgaatctggtattcctgaatcatttaacgtgatgataaaagaatttaga
tctttatgtcttaatgtaaaacttgaagtgacttcttaa

DBGET integrated database retrieval system