KEGG   Rickettsia bellii OSU 85-389: A1I_02060Help
Entry
A1I_02060         CDS       T00602                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A1I_02060 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rbo03011]
    A1I_02060 (rplV)
Ribosome [BR:rbo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1I_02060 (rplV)
  Bacteria
    A1I_02060 (rplV)
  Archaea
    A1I_02060 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 B2
Motif
Other DBs
NCBI-ProteinID: ABV78796
UniProt: A8GVB9
Position
391566..391925
Genome map
AA seq 119 aa AA seqDB search
MVQENKNFATAKAKSIRVSPRKLNLVAAFIRNMKVSEALVQLTFSPKRISKVVKACLQSA
VANAENNLGLDIDRLVITNATVGKALVMKRVMPRAKGRATRINKFFSNLYITVTEKEDN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtacaggaaaacaaaaattttgccacggcaaaagctaaatcaattagagttagtcca
aggaaattaaacttagttgcagcttttattagaaacatgaaagtttctgaagcattagtg
caattaactttttcgccaaaaagaatttcaaaagttgtaaaagcttgtctgcaatctgct
gtagcaaatgctgaaaataatctaggtttagatatagatagattagttataactaacgca
acagtaggcaaggctttagtaatgaaaagagttatgccaagagcaaaaggaagagctact
agaataaataagttttttagtaatctttatataactgttacagaaaaagaggataattaa

DBGET integrated database retrieval system