KEGG   Rickettsia bellii OSU 85-389: A1I_02285Help
Entry
A1I_02285         CDS       T00602                                 

Definition
(GenBank) VirD4
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A1I_02285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbo02044]
    A1I_02285
Enzymes [BR:rbo01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     A1I_02285
Secretion system [BR:rbo02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   A1I_02285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: ABV78833
Position
complement(423890..425668)
Genome map
AA seq 592 aa AA seqDB search
MGWHNILKVTRNIFGHAIIHPVVIFSTLWISGAFVAIFTNEIGTLGVDVTAINIAYKWSY
WLVSVWGQLKISDYNYLKLKLLASLLGPALVVIIFYIKNFERIKSLQFFEQPEKVYGDAR
WASPADVESAGLRAKKGMLIGVDSGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSD
SVVVHDIKLENHGLTSGWREKQGQKVFVWEPSNPDGITHCYNPIDWVSTKPGQMVDDVQK
ISNLIMPEKDFWNNEARSLFLGVTLYLIADPVKTKSFGEVVRTMRSDDVVYNLAVVLDTL
GGIIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSDFNVQEFKKIK
TTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNSTYRITFAANNYETANLISQL
VGNKTVEQRSFSKPIFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIK
SRKIKYFEDKFFTSRLLPPTFVPTQVPFDPRANNNETSNETEEAAVAPENSE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggatggcataacatactcaaagtcactagaaatatattcggtcatgctataattcat
ccggttgttatttttagtaccttatggataagtggtgcatttgttgcaatctttaccaat
gaaattgggactcttggagtagatgtaactgctataaatattgcttacaaatggtcttat
tggcttgttagcgtttggggacaattaaaaatctctgattataactatttaaaattaaag
ctacttgcttcacttcttggtcctgctcttgtcgttataatattttacattaaaaacttt
gagagaatcaaatcgctacaattttttgagcaacctgaaaaagtctatggtgatgctagg
tgggcaagtcctgcagatgttgaatcggctggtcttagagctaaaaaaggtatgctaatc
ggggttgatagtggtggttattttgttgctgatggattccagcacgccttattatttgct
cctaccggttctggtaaaggtgtgggttttgttatacctaacctattattttggtctgat
tccgtagtcgttcatgatataaaacttgaaaaccatggcttaacgagcggttggcgtgaa
aaacaaggtcagaaagtctttgtatgggagccatctaacccagatggtattactcactgc
tataatccgattgactgggttagtactaagcctgggcaaatggttgatgacgtacaaaaa
atttcaaaccttatcatgcctgaaaaggatttctggaataacgaagcacgaagcttattc
ttgggcgtaactttatatttaatagctgatcctgttaaaaccaaatcctttggtgaagtg
gtgcgtaccatgagaagtgacgatgtagtatataatctggcggtcgtgcttgatacttta
ggcggaataatccaccctgttgcatatatgaatattgcagctttcctacaaaaagccgat
aaagagcgttcaggtgttatatcaaccatgaactcatcacttgagttatgggcaaaccca
ttaattgactctgctactgcttcttccgattttaatgtacaagaattcaagaaaataaaa
acaactgtatatgtaggtcttactcctgataatatacaacgtttgcagaaattaatgcag
gtattttatcagcaagctacagagtttttaagccgaaaaatgcctgatttaaaagaagaa
ccttacggcgtgatgttcttacttgatgagttcccaacacttggtaagatggatacgttc
aaagcaggtattgcttatttcagggggtatagagttcgtttattcttaattattcaagat
acccagcagctaaaaggaacatatgaagatgcgggtatgaactctttcttatctaactca
acatatcgtattacctttgctgctaataactatgaaactgcaaatttaatatcacaatta
gtcggtaataaaactgtagaacaaagatcattcagcaaacctatattttttgatcttaat
atttctactagaacacaaaatgtttctcaagttcaaagggctttacttttacctcaagaa
gtaatacagttaccaagagacgagcagattgttttaatagagtcttttcctccgataaaa
tctcgtaagattaaatattttgaggataagttttttactagtagattattaccgccgact
tttgtacctactcaagtaccttttgatccacgagcaaataataatgaaacttctaatgag
acagaagaggctgctgttgctccagaaaacagtgagtaa

DBGET integrated database retrieval system