KEGG   Rickettsia bellii OSU 85-389: A1I_03430Help
Entry
A1I_03430         CDS       T00602                                 

Gene name
ileS
Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
rbo  Rickettsia bellii OSU 85-389
Pathway
rbo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A1I_03430 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rbo01007]
    A1I_03430 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbo03016]
    A1I_03430 (ileS)
Enzymes [BR:rbo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     A1I_03430 (ileS)
Amino acid related enzymes [BR:rbo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A1I_03430 (ileS)
Transfer RNA biogenesis [BR:rbo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A1I_03430 (ileS)
 Prokaryotic Type
   Other AARSs
    A1I_03430 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABV79045
UniProt: A8GW18
Position
complement(636444..639770)
Genome map
AA seq 1108 aa AA seqDB search
MTNTKYYPEVSSNADFATIEKEILKFWQDNNIFQKSIDIREGDAEFIFYDGPPFANGLPH
YGHLLTGFIKDVYARYQTVRGKKVERRFGWDCHGLPAEMQSEKELGISGHLAITNFGIEK
FNAHCRDSVMKYAGEWEQYVTRQARWVDFKNSYKTMDKNFMESVLWAFKELYNKGLLYES
MRVMPYSWACETPLSNFETRLDNSYRERADKAVTVSFVLCHPVSKSTLDVIPWLDHGIQK
TINNDSANCSMDPVDKPRYDTENFLGITANYKEYRILAWTTTTWTLPSNLALAVGSDIDY
ALVPKGDVCYIIAASSVSKYAKELELKGDEQFTIIKGSELQGLSYKPLFDYFKNHPNSFK
IFAGDFVVEGDGTGVVHMAPGFGEDDQILCESKGIKLVCPVDNSGKFTKEIPDLEGLQVF
DANDKIIIKLKEQGNWLKTEQYIHNYPHCWRTDTPLIYKAVPSWYVKVTEFKDRMVELNQ
QINWIPTHVKDNLFGKWLENARDWSISRNRFWGTPLPVWKSDDPKYPRIDVYGSIEELEK
DFGVKITDLHRPFIDELTRANPDDPTGKSTMRRIEDVFDCWFESGSMPYGQAHYPFENKQ
WFEEHFPADFIVEYSAQTRGWFYTLMVLSTALFDRPPFLNCICHGVILDATGQKLSKRLN
NYADPLELFDKYGSDALRVTMLSSNVVKGQELLIDKDGKMVFDTLRLFIKPIWNAYHFFT
MYANADHIKGELNFTSENVLDVYILSKLKIAVEKIKESLDSFDTGTAYHAVSEFFEVLNN
WYIRRSRARFWKSEKDADKQSAYNTLYTCLETMAIAMSSLVPLISEAIYLGLYCHPRKSG
DPEKPECLDSRLCGNDNLSVHLCDYPDLSKFKINSELVDTMDTVLDICNHSLFIRSSENA
RVRQPLSSITIISKNNDKLKSFEDLIKDEINVKSVIYRDDLENYAVKKLSINFPLLGKRL
PAKMKDIIAASKKNEWEVTSGSLIICNETLNSDEYKLILEPHSHIKGASSFAHNSSLLIL
DLELTPELIDEGIARDIVRFIQQARKNADFAITDRILIDINLPKITDIYGEFIKEQTLGK
FAKDFIPDHISEIELDNHKLQLKIKKVN
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacactaaatattacccagaagttagctcaaatgctgattttgctaccatagaa
aaagaaatattaaaattttggcaagataataatatattccaaaaatctattgatattaga
gagggcgatgctgagtttatcttttacgatggtccgccttttgctaatgggttaccgcat
tatggacacttactaactggctttattaaagacgtatatgctagatatcaaacggttaga
gggaagaaagtagaacgtcgtttcggttgggattgtcacggactacctgctgaaatgcaa
tctgaaaaggaactcggtatttcagggcatcttgctattactaattttgggatagagaag
tttaacgctcattgtagagattcggtaatgaaatatgccggtgagtgggagcaatatgta
acacgtcaagcaagatgggtagattttaaaaattcttacaaaacaatggataagaatttt
atggaatccgtgctttgggcattcaaagagttatataataaaggattattgtacgaatct
atgcgagttatgccttattcgtgggcatgcgaaacaccactttctaactttgaaacaaga
cttgataattcatatagagagcgagcagataaagcagtaacggttagttttgtactatgt
catcccgtgagcaaaagcacgctcgatgtcataccgtggcttgaccacggtatccagaaa
acaataaataatgatagtgctaattgttctatggatcccgtggacaagccacggtatgac
accgagaattttttaggaataacagctaattacaaagagtaccgtatcctcgcctggacg
actaccacttggacattgccgtcaaatctagccttagcagttggtagcgatatcgattat
gcgttagttcctaaaggcgatgtctgttatatcatagctgcctcatctgtttctaaatac
gctaaagaattagagctaaaaggcgatgagcaattcacaataattaaaggctcagagctt
caaggattaagctataagccgctatttgactatttcaaaaatcatccgaatagctttaag
atatttgccggcgattttgttgttgagggtgacggcacaggggtagtacatatggctcct
ggctttggtgaagatgaccaaatactttgtgaatcgaaaggcataaagctcgtttgccct
gtggataatagtggtaagttcaccaaagaaatacctgatttagagggcttacaagtattt
gatgcaaacgataaaataataatcaagctgaaagagcaaggaaattggctaaaaaccgag
caatatattcacaattatccgcattgctggcgaaccgatacgcctcttatatataaagct
gttccatcatggtatgtaaaagttaccgaatttaaagacagaatggtagagctgaatcag
caaattaattggataccaacgcatgttaaagataatttatttggtaaatggcttgagaat
gctagggattggtcaataagccgtaatagattctggggaacacctttgccggtatggaag
tctgacgatccaaaatatccacgcatagatgtttacggctctatagaagagctagaaaaa
gattttggtgttaagattactgatttacatcgtccatttattgacgagttaacgcgggcc
aatcccgacgatccaactggtaaatcaacaatgcgtagaatagaagacgtatttgactgt
tggtttgaaagtggttcaatgccgtacggacaagcacactacccttttgaaaataagcag
tggtttgaggaacattttccggcagatttcatagttgagtattccgcacaaacacgtggt
tggttctatactttaatggtgttatctactgccctatttgatcgtccgccatttttaaat
tgtatatgccacggggtgattttagatgctacgggtcaaaagctttcaaagcgtctaaat
aactatgccgatccactggagctattcgataaatatggctcagatgccttaagggtaaca
atgctttcttccaatgtagttaaagggcaagagctactaattgataaagatggtaaaatg
gtatttgatacgcttcgtttgtttatcaagcctatctggaatgcttaccatttcttcacg
atgtatgctaatgctgaccatattaaaggtgagttaaattttacatctgaaaacgttctt
gatgtatatatattatccaaactcaaaatagcggtagaaaaaattaaagaaagtttagac
agcttcgatactgggacggcttatcatgctgtttcagaattttttgaagtactaaacaac
tggtacataagacgaagcagagctagattttggaaaagcgaaaaggatgcagataaacaa
agtgcctataatacgctatacacgtgcttagaaactatggctattgcgatgtcgtcttta
gtgccgcttatctccgaagcgatatatttagggctatattgtcatcctcgcaaaagcggg
gatccagaaaaacctgaatgcctagattcccgcctatgcgggaatgacaatttatccgtc
catctttgcgactatcctgatctttcaaagttcaaaataaacagcgagctagtggatact
atggatactgtgctagatatttgcaaccacagcctattcatcagaagtagcgaaaacgca
cgtgtaagacaaccacttagcagtataactattattagcaaaaataacgataagcttaaa
agttttgaagatttaattaaagatgaaatcaatgttaaatcagtaatttatcgtgatgat
ttagaaaattatgcagttaaaaaattatcgattaatttcccgttacttggtaagcgtcta
ccggctaaaatgaaagatatcatagctgcctctaaaaagaacgagtgggaagtaacctct
ggcagcttgataatctgtaatgagaccttaaatagcgatgaatataaactaatcttagaa
cctcattcgcatattaaaggggctagcagctttgcccataatagcagtctgctcatactt
gatctagagctaacccctgagttaatagacgaaggaatagctcgtgacattgtacgcttc
atacaacaagctcgaaaaaatgccgattttgctataacagatagaattttgattgatata
aatttgcctaaaataactgatatttacggtgagtttattaaagagcaaaccttaggtaaa
tttgctaaagattttattcctgatcatattagtgaaatcgagctagacaaccacaaacta
caactaaagattaagaaagtaaactga

DBGET integrated database retrieval system