KEGG   Rickettsia bellii OSU 85-389: A1I_05570Help
Entry
A1I_05570         CDS       T00602                                 

Definition
(GenBank) Conjugative transfer protein TraW
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbo02044]
    A1I_05570
Secretion system [BR:rbo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A1I_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HK97-gp10_like
Motif
Other DBs
NCBI-ProteinID: ABV79441
Position
1059757..1060440
Genome map
AA seq 227 aa AA seqDB search
MTGYLDLKIIIISSFVLFVIMLKVSYVNAHNNNLAISIDNNSKIEIRDYEVQGHVFPIIE
ESLLEVIMAKLQIAKQNGVLEKMQEEFKNKVQQKISRPTPVLALAKASINRNWHYDPSFI
QKTDVKDQAGNIIVKVGTNVNPLEKISWGKALIFIDGDDEQQVKWAKSKIGKLVLTSGNP
IKLAQKLNKPVFFDQGGVLTTRFKIKAVPAIARQEGKLLKISEIKIN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgacagggtatttagatctaaaaattattattataagttcctttgttttatttgttatt
atgttgaaggtaagttatgtaaatgcacacaataataatttggctataagcatagataat
aattctaaaatagaaattagagattatgaagtccaaggtcatgtatttccaattattgaa
gagtcattactagaggtcattatggctaaacttcaaatagcaaaacaaaatggcgtttta
gagaaaatgcaggaagaatttaaaaataaggtacagcaaaaaatatcaagaccaactccg
gtattggctctagcaaaagcaagcataaaccgaaattggcactatgatccgagctttata
caaaagacagatgtaaaagatcaagcaggaaacatcatagtaaaagttggcacaaatgta
aatcctttggagaaaataagctggggaaaagctttaatatttattgatggtgatgatgag
cagcaagttaagtgggctaaatcaaaaataggaaaattagtactcacgagtggcaatcct
attaagctagcacaaaagttaaataagccagtgttttttgatcaaggtggcgtgcttact
actcgttttaaaataaaagcagtaccggctattgcccggcaggaaggtaaattacttaaa
attagcgaaatcaagattaattaa

DBGET integrated database retrieval system