KEGG   Rickettsia bellii OSU 85-389: A1I_05590Help
Entry
A1I_05590         CDS       T00602                                 

Definition
(GenBank) Conjugative transfer protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
rbo  Rickettsia bellii OSU 85-389
Brite
KEGG Orthology (KO) [BR:rbo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rbo02044]
    A1I_05590
Secretion system [BR:rbo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A1I_05590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraN
Motif
Other DBs
NCBI-ProteinID: ABV79445
Position
1062159..1063970
Genome map
AA seq 603 aa AA seqDB search
MRQSINIIMLVTLVMNAISSYSATMEDSYNSARQYEHSIKLGNPDQIGNKIIFDKEVNIS
NLSKMNDQDLTNQGSVMLNNSAQGQLLQQSELKKINAMQEYDLNPNNPVISNSAKIEAEP
LRHTEGTALNVSEKVIKTKINKSCCEGVEFEIDVIRNLILDAELIDKWGDWQDKAIAFSG
LEISNSYRHWLYPVFWKKKRRLGKRKTIYSMHMHNNQIIMEEVRAAIVAKLNTSLDHIDT
YIGISPQGEGALTEAWDGDIVKWDRYVFTYKYRDKIKVFREKGEYFQIVNELSEALVEEN
ECHEINRICLEAGNKLFFNQYNVNRPCWSEQIKYQCSSEPKYGCDHLKKQGCELARSNCI
RQAASICLQWHKDYICSNEKKELSSSIAGSQMFCLGGNRHTATIVPNTDMGSVGYLAMLN
EMKKDMQTNPISVFKGHANSCRKTNIGNFLNCCSGFKGWGKDLGLSRCNAEEKALALKRA
KGQCNYVGTYCAKKDKIFKTCITKKSTYCCFNSKLARVFQEQGKKQLAISFGTGQQANCR
GFTVEELQRIDFSKFDLEELFSDLLDHAKSKINKNFPQQLKNQMPIMQQQKFNNNHTDSN
LSY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaagtattaatattattatgttagttactttagtgatgaatgcgatcagttct
tactctgctactatggaggatagttataatagtgccagacagtatgaacacagtattaag
cttggtaatcctgatcaaataggcaataagataatatttgataaagaggtaaatatatca
aatttaagtaaaatgaatgatcaagacttaacaaatcaaggtagtgttatgttaaataac
tctgcacaagggcaattactgcaacaaagtgagctgaagaaaataaatgcaatgcaagaa
tatgaccttaatcctaacaatcccgtaattagtaattcagctaagattgaggcagagcca
ttaaggcatacagaagggactgcacttaatgttagtgaaaaagtaattaaaaccaaaatt
aataagagttgctgtgaaggggtagaatttgaaatagatgttatcaggaatcttatacta
gatgctgaattaatagataaatggggtgattggcaagataaagcaatagcattttcaggt
cttgagataagtaacagttatcgtcactggctttatcctgtcttttggaagaagaaaaga
cgtttaggtaagcgtaaaacaatatacagcatgcatatgcataataatcagatcataatg
gaagaagtgagagcagctattgttgctaagttaaatacttcccttgatcatattgataca
tatatcggcatttctcctcaaggagaaggagcattaactgaagcctgggatggtgatata
gtaaaatgggatagatatgtttttacttataaatatcgtgataagattaaagtatttaga
gaaaaaggtgagtacttccaaatagtaaatgagctttcagaagctttagttgaggaaaat
gaatgccatgaaataaatcgcatatgtcttgaagctggtaataagttgttttttaatcaa
tataatgttaatcgtccatgctggagcgagcaaattaaatatcaatgtagtagtgagcca
aaatatgggtgtgatcatttaaagaagcaaggttgtgaacttgcaaggagcaattgcatt
aggcaagctgctagtatctgtttgcaatggcacaaagattacatatgctctaatgagaaa
aaagagcttagctcctctatagcaggatcacaaatgttttgtttaggagggaatcgtcat
actgcaactattgtgccaaatactgatatggggagtgttgggtatcttgcaatgttaaat
gaaatgaaaaaagatatgcagacaaatccgatttcagtatttaaaggtcatgccaacagt
tgccgcaaaacaaatattggcaattttcttaattgttgctctggattcaaaggttggggt
aaggatttagggctgagccggtgtaatgcagaagaaaaagccttagccttaaaaagggca
aaaggtcagtgtaactatgttgggacatattgtgctaagaaagataaaatatttaagaca
tgtattactaaaaaatctacttattgttgttttaattcaaaacttgcaagagtttttcaa
gagcaaggaaaaaaacaattagctattagttttggcacagggcagcaggctaattgtcgt
gggtttacagtagaagagctgcaaagaatagatttttctaaatttgatttagaggagcta
tttagtgatttacttgatcatgctaaaagtaaaataaataagaactttccgcagcaacta
aaaaaccagatgcctataatgcaacaacaaaaatttaataataatcatactgattcaaat
ttatcctattaa

DBGET integrated database retrieval system